From 67292b53cd6ab97fad9c5f77cc2edd9ad5d2b2a6 Mon Sep 17 00:00:00 2001 From: schaefi Date: Wed, 27 Nov 2024 09:02:30 +0000 Subject: [PATCH] deploy: 3fa135e64caa18f674f9c5f5c9e28458db03fa12 --- .buildinfo | 2 +- .doctrees/api.doctree | Bin 4209 -> 4209 bytes .doctrees/commands.doctree | Bin 3643 -> 3643 bytes .doctrees/concept_and_workflow.doctree | Bin 50485 -> 50485 bytes .doctrees/contributing.doctree | Bin 57594 -> 57594 bytes .../contributing/kiwi_from_python.doctree | Bin 7743 -> 7743 bytes .../contributing/schema_extensions.doctree | Bin 16385 -> 16385 bytes .doctrees/environment.pickle | Bin 2744663 -> 2744663 bytes .doctrees/image_description.doctree | Bin 16866 -> 16866 bytes .doctrees/image_description/elements.doctree | Bin 385405 -> 385405 bytes .doctrees/index.doctree | Bin 30806 -> 30806 bytes .doctrees/overview.doctree | Bin 18521 -> 18521 bytes .doctrees/overview/workflow.doctree | Bin 23107 -> 23107 bytes .doctrees/plugins.doctree | Bin 3485 -> 3485 bytes .doctrees/quickstart.doctree | Bin 12956 -> 12956 bytes .../build_in_buildservice.doctree | Bin 60312 -> 60312 bytes _modules/index.html | 4 ++-- _modules/kiwi/app.html | 4 ++-- _modules/kiwi/archive/cpio.html | 4 ++-- _modules/kiwi/archive/tar.html | 4 ++-- _modules/kiwi/boot/image.html | 4 ++-- _modules/kiwi/boot/image/base.html | 4 ++-- _modules/kiwi/boot/image/builtin_kiwi.html | 4 ++-- _modules/kiwi/boot/image/dracut.html | 4 ++-- _modules/kiwi/bootloader/config.html | 4 ++-- _modules/kiwi/bootloader/config/base.html | 4 ++-- _modules/kiwi/bootloader/config/grub2.html | 4 ++-- .../kiwi/bootloader/config/systemd_boot.html | 4 ++-- _modules/kiwi/bootloader/config/zipl.html | 4 ++-- _modules/kiwi/bootloader/install.html | 4 ++-- _modules/kiwi/bootloader/install/base.html | 4 ++-- _modules/kiwi/bootloader/install/grub2.html | 4 ++-- .../kiwi/bootloader/install/systemd_boot.html | 4 ++-- _modules/kiwi/bootloader/install/zipl.html | 4 ++-- _modules/kiwi/bootloader/template/grub2.html | 4 ++-- _modules/kiwi/builder.html | 4 ++-- _modules/kiwi/builder/archive.html | 4 ++-- _modules/kiwi/builder/container.html | 4 ++-- _modules/kiwi/builder/disk.html | 4 ++-- _modules/kiwi/builder/filesystem.html | 4 ++-- _modules/kiwi/builder/install.html | 4 ++-- _modules/kiwi/builder/kis.html | 4 ++-- _modules/kiwi/builder/live.html | 4 ++-- _modules/kiwi/cli.html | 4 ++-- _modules/kiwi/command.html | 4 ++-- _modules/kiwi/command_process.html | 4 ++-- _modules/kiwi/container.html | 4 ++-- _modules/kiwi/container/oci.html | 4 ++-- _modules/kiwi/container/setup.html | 4 ++-- _modules/kiwi/container/setup/base.html | 4 ++-- _modules/kiwi/container/setup/docker.html | 4 ++-- _modules/kiwi/defaults.html | 4 ++-- _modules/kiwi/exceptions.html | 4 ++-- _modules/kiwi/filesystem.html | 4 ++-- _modules/kiwi/filesystem/base.html | 4 ++-- _modules/kiwi/filesystem/btrfs.html | 4 ++-- _modules/kiwi/filesystem/ext2.html | 4 ++-- _modules/kiwi/filesystem/ext3.html | 4 ++-- _modules/kiwi/filesystem/ext4.html | 4 ++-- _modules/kiwi/filesystem/fat16.html | 4 ++-- _modules/kiwi/filesystem/fat32.html | 4 ++-- _modules/kiwi/filesystem/isofs.html | 4 ++-- _modules/kiwi/filesystem/setup.html | 4 ++-- _modules/kiwi/filesystem/squashfs.html | 4 ++-- _modules/kiwi/filesystem/xfs.html | 4 ++-- _modules/kiwi/firmware.html | 4 ++-- _modules/kiwi/help.html | 4 ++-- _modules/kiwi/iso_tools.html | 4 ++-- _modules/kiwi/iso_tools/base.html | 4 ++-- _modules/kiwi/iso_tools/iso.html | 4 ++-- _modules/kiwi/iso_tools/xorriso.html | 4 ++-- _modules/kiwi/kiwi.html | 4 ++-- _modules/kiwi/logger.html | 4 ++-- _modules/kiwi/logger_color_formatter.html | 4 ++-- _modules/kiwi/logger_filter.html | 4 ++-- _modules/kiwi/mount_manager.html | 4 ++-- _modules/kiwi/package_manager.html | 4 ++-- _modules/kiwi/package_manager/base.html | 4 ++-- _modules/kiwi/package_manager/dnf4.html | 4 ++-- _modules/kiwi/package_manager/zypper.html | 4 ++-- _modules/kiwi/partitioner.html | 4 ++-- _modules/kiwi/partitioner/base.html | 4 ++-- _modules/kiwi/partitioner/dasd.html | 4 ++-- _modules/kiwi/partitioner/gpt.html | 4 ++-- _modules/kiwi/partitioner/msdos.html | 4 ++-- _modules/kiwi/path.html | 4 ++-- _modules/kiwi/privileges.html | 4 ++-- _modules/kiwi/repository.html | 4 ++-- _modules/kiwi/repository/base.html | 4 ++-- _modules/kiwi/repository/dnf4.html | 4 ++-- _modules/kiwi/repository/template/apt.html | 4 ++-- _modules/kiwi/repository/zypper.html | 4 ++-- _modules/kiwi/runtime_checker.html | 4 ++-- _modules/kiwi/runtime_config.html | 4 ++-- _modules/kiwi/solver/repository.html | 4 ++-- _modules/kiwi/solver/repository/base.html | 4 ++-- _modules/kiwi/solver/repository/rpm_dir.html | 4 ++-- _modules/kiwi/solver/repository/rpm_md.html | 4 ++-- _modules/kiwi/solver/repository/suse.html | 4 ++-- _modules/kiwi/solver/sat.html | 4 ++-- _modules/kiwi/storage/clone_device.html | 4 ++-- _modules/kiwi/storage/device_provider.html | 4 ++-- _modules/kiwi/storage/disk.html | 4 ++-- _modules/kiwi/storage/loop_device.html | 4 ++-- _modules/kiwi/storage/luks_device.html | 4 ++-- _modules/kiwi/storage/mapped_device.html | 4 ++-- _modules/kiwi/storage/raid_device.html | 4 ++-- _modules/kiwi/storage/setup.html | 4 ++-- _modules/kiwi/storage/subformat.html | 4 ++-- _modules/kiwi/storage/subformat/base.html | 4 ++-- _modules/kiwi/storage/subformat/gce.html | 4 ++-- _modules/kiwi/storage/subformat/ova.html | 4 ++-- _modules/kiwi/storage/subformat/qcow2.html | 4 ++-- .../subformat/template/vagrant_config.html | 4 ++-- .../subformat/template/virtualbox_ovf.html | 4 ++-- .../subformat/template/vmware_settings.html | 4 ++-- .../kiwi/storage/subformat/vagrant_base.html | 4 ++-- .../storage/subformat/vagrant_libvirt.html | 4 ++-- .../storage/subformat/vagrant_virtualbox.html | 4 ++-- _modules/kiwi/storage/subformat/vdi.html | 4 ++-- _modules/kiwi/storage/subformat/vhd.html | 4 ++-- _modules/kiwi/storage/subformat/vhdfixed.html | 4 ++-- _modules/kiwi/storage/subformat/vhdx.html | 4 ++-- _modules/kiwi/storage/subformat/vmdk.html | 4 ++-- _modules/kiwi/system/identifier.html | 4 ++-- _modules/kiwi/system/kernel.html | 4 ++-- _modules/kiwi/system/prepare.html | 4 ++-- _modules/kiwi/system/profile.html | 4 ++-- _modules/kiwi/system/result.html | 4 ++-- _modules/kiwi/system/root_bind.html | 4 ++-- _modules/kiwi/system/root_init.html | 4 ++-- _modules/kiwi/system/setup.html | 4 ++-- _modules/kiwi/system/shell.html | 4 ++-- _modules/kiwi/system/size.html | 4 ++-- _modules/kiwi/system/uri.html | 4 ++-- _modules/kiwi/system/users.html | 4 ++-- _modules/kiwi/tasks/base.html | 4 ++-- _modules/kiwi/tasks/result_bundle.html | 4 ++-- _modules/kiwi/tasks/result_list.html | 4 ++-- _modules/kiwi/tasks/system_build.html | 4 ++-- _modules/kiwi/tasks/system_create.html | 4 ++-- _modules/kiwi/tasks/system_prepare.html | 4 ++-- _modules/kiwi/tasks/system_update.html | 4 ++-- _modules/kiwi/utils/block.html | 4 ++-- _modules/kiwi/utils/checksum.html | 4 ++-- _modules/kiwi/utils/compress.html | 4 ++-- _modules/kiwi/utils/sync.html | 4 ++-- _modules/kiwi/utils/sysconfig.html | 4 ++-- _modules/kiwi/volume_manager.html | 4 ++-- _modules/kiwi/volume_manager/base.html | 4 ++-- _modules/kiwi/volume_manager/btrfs.html | 4 ++-- _modules/kiwi/volume_manager/lvm.html | 4 ++-- _modules/kiwi/xml_description.html | 4 ++-- _modules/kiwi/xml_state.html | 4 ++-- _static/documentation_options.js | 2 +- api.html | 6 +++--- api/kiwi.archive.html | 4 ++-- api/kiwi.boot.html | 4 ++-- api/kiwi.boot.image.html | 4 ++-- api/kiwi.bootloader.config.html | 4 ++-- api/kiwi.bootloader.html | 4 ++-- api/kiwi.bootloader.install.html | 4 ++-- api/kiwi.bootloader.template.html | 4 ++-- api/kiwi.builder.html | 4 ++-- api/kiwi.container.html | 4 ++-- api/kiwi.container.setup.html | 4 ++-- api/kiwi.filesystem.html | 4 ++-- api/kiwi.html | 4 ++-- api/kiwi.iso_tools.html | 4 ++-- api/kiwi.package_manager.html | 4 ++-- api/kiwi.partitioner.html | 4 ++-- api/kiwi.repository.html | 4 ++-- api/kiwi.repository.template.html | 4 ++-- api/kiwi.solver.html | 4 ++-- api/kiwi.solver.repository.html | 4 ++-- api/kiwi.storage.html | 4 ++-- api/kiwi.storage.subformat.html | 4 ++-- api/kiwi.storage.subformat.template.html | 4 ++-- api/kiwi.system.html | 4 ++-- api/kiwi.tasks.html | 4 ++-- api/kiwi.utils.html | 4 ++-- api/kiwi.volume_manager.html | 4 ++-- building_images.html | 4 ++-- building_images/build_container_image.html | 4 ++-- building_images/build_enclave.html | 4 ++-- building_images/build_expandable_disk.html | 4 ++-- building_images/build_kis.html | 4 ++-- building_images/build_live_iso.html | 4 ++-- building_images/build_simple_disk.html | 4 ++-- building_images/build_wsl_container.html | 4 ++-- commands.html | 6 +++--- commands/image_info.html | 4 ++-- commands/image_resize.html | 4 ++-- commands/kiwi.html | 4 ++-- commands/result_bundle.html | 4 ++-- commands/result_list.html | 4 ++-- commands/system_build.html | 4 ++-- commands/system_create.html | 4 ++-- commands/system_prepare.html | 4 ++-- commands/system_update.html | 4 ++-- concept_and_workflow.html | 6 +++--- .../customize_the_boot_process.html | 4 ++-- concept_and_workflow/packages.html | 4 ++-- concept_and_workflow/profiles.html | 4 ++-- concept_and_workflow/repository_setup.html | 4 ++-- .../runtime_configuration.html | 4 ++-- concept_and_workflow/shell_scripts.html | 4 ++-- concept_and_workflow/systemdeps.html | 4 ++-- concept_and_workflow/users.html | 4 ++-- contributing.html | 6 +++--- contributing/kiwi_from_python.html | 6 +++--- contributing/kiwi_plugin_architecture.html | 4 ++-- contributing/schema_extensions.html | 6 +++--- contributing/scripts_testing.html | 4 ++-- genindex.html | 4 ++-- image_description.html | 6 +++--- image_description/elements.html | 6 +++--- image_types_and_results.html | 4 ++-- index.html | 6 +++--- installation.html | 4 ++-- objects.inv | Bin 15861 -> 15861 bytes overview.html | 6 +++--- overview/workflow.html | 6 +++--- plugins.html | 6 +++--- plugins/self_contained.html | 4 ++-- plugins/stackbuild.html | 4 ++-- py-modindex.html | 4 ++-- quickstart.html | 6 +++--- search.html | 4 ++-- searchindex.js | 2 +- troubleshooting.html | 4 ++-- troubleshooting/architectures.html | 4 ++-- troubleshooting/boxbuild_tweaks.html | 4 ++-- troubleshooting/buildhost_constraints.html | 4 ++-- troubleshooting/filesystems.html | 4 ++-- troubleshooting/security.html | 4 ++-- working_with_images.html | 4 ++-- .../build_in_buildservice.html | 6 +++--- working_with_images/build_with_profiles.html | 4 ++-- .../build_without_debianbootstrap.html | 4 ++-- working_with_images/clone_partitions.html | 4 ++-- .../custom_fstab_extension.html | 4 ++-- working_with_images/custom_partitions.html | 4 ++-- working_with_images/custom_volumes.html | 4 ++-- .../disk_ramdisk_deployment.html | 4 ++-- working_with_images/disk_setup_for_azure.html | 4 ++-- working_with_images/disk_setup_for_ec2.html | 4 ++-- .../disk_setup_for_google.html | 4 ++-- working_with_images/disk_setup_for_luks.html | 4 ++-- .../disk_setup_for_vagrant.html | 4 ++-- .../iso_to_usb_stick_deployment.html | 4 ++-- ...so_to_usb_stick_file_based_deployment.html | 4 ++-- .../iso_to_usb_stick_grub2_boot_from_iso.html | 4 ++-- .../legacy_netboot_root_filesystem.html | 4 ++-- .../network_live_iso_boot.html | 4 ++-- working_with_images/network_overlay_boot.html | 4 ++-- .../setup_network_bootserver.html | 4 ++-- .../setup_yast_on_first_boot.html | 4 ++-- working_with_images/use_suse_media.html | 4 ++-- 259 files changed, 497 insertions(+), 497 deletions(-) diff --git a/.buildinfo b/.buildinfo index 02a7a995540..92c60217646 100644 --- a/.buildinfo +++ b/.buildinfo @@ -1,4 +1,4 @@ # Sphinx build info version 1 # This file hashes the configuration used when building these files. When it is not found, a full rebuild will be done. -config: 18a4e8fa923dbd081a0030ec79c166d2 +config: 885ae771f89ea712e771ae0472d544c2 tags: 645f666f9bcd5a90fca523b33c5a78b7 diff --git a/.doctrees/api.doctree b/.doctrees/api.doctree index 13d3ce0a5e1187f626f162f89338c78cd893dc7c..16c7e0a865e11cd7007240366e303d39f2f729db 100644 GIT binary patch delta 14 WcmeyU@KIsIG$ux)&C{7~@d5xalLgTL delta 14 WcmeyU@KIsIG$uyF&C{7~@d5xajRnvE diff --git a/.doctrees/commands.doctree b/.doctrees/commands.doctree index 176fa10f76ed15252e57dcaa2b6acde64a0614fc..4eb036345614733baf1204f1f3f3cc5f91b07eef 100644 GIT binary patch delta 14 Vcmdljvs-3^3p1n9W>@BKTmUA`1k?Zk delta 14 Vcmdljvs-3^3p1nPW>@BKTmUA=1k(Tj diff --git a/.doctrees/concept_and_workflow.doctree b/.doctrees/concept_and_workflow.doctree index b35b454a69e4352099d2ad68125f982e0683a139..20d9dd52d0a9a5f6bee9220eda4f7f2438708a00 100644 GIT binary patch delta 16 Xcmdnm#k{qPc>@azqtRwo7K4KTFo6Xf delta 16 Xcmdnm#k{qPc>@azqv2*&7K4KTFna|Y diff --git a/.doctrees/contributing.doctree b/.doctrees/contributing.doctree index 24dcca79722d7e929fcf0ed3234d145164167c59..4479c9c30576943432fd9c0c3c49c3e49339e806 100644 GIT binary patch delta 16 Ycmex$kong^<_+d7j7FO+SPtC*073N!C;$Ke delta 16 Ycmex$kong^<_+d7jE0*nSPtC*0735uCjbBd diff --git a/.doctrees/contributing/kiwi_from_python.doctree b/.doctrees/contributing/kiwi_from_python.doctree index 2d5bbf6d7887ba40eaa5d1d95e3bcf9d0f8bb6f1..ee1ded52e81b94f7bbc4b21756995456be7d37cd 100644 GIT binary patch delta 14 VcmdmQv)^VzBrBuQ<|x*u5&$bm1xEk? delta 14 VcmdmQv)^VzBrBug<|x*u5&$bg1x5e> diff --git a/.doctrees/contributing/schema_extensions.doctree b/.doctrees/contributing/schema_extensions.doctree index 75e7fb5e8e57282b24a39ea19e605681c2aecf45..fe90111a05989f814af9f3c231dbe8e4dba7ba94 100644 GIT binary patch delta 16 XcmZo{U~Ft)+@R0PXtddY_o5L1ETRP$ delta 16 XcmZo{U~Ft)+@R0PXt>#c_o5L1ESv=v diff --git a/.doctrees/environment.pickle b/.doctrees/environment.pickle index 6e75df9a4ca47b5577f0db844d2f8b27197e8d86..9f819c745221901f6d027a567aa775761e3a0af0 100644 GIT binary patch delta 93802 zcmZ@>2Ygh;)_>dX-Q8@mCA}vsy(LOjT2Q)_*q%xY9kM_Y2mz6jfQYyRh)l?cw1`L- zq6nkZD1xFi6+6ueDgydYtnmHM+0|uA>V(;J z`;L?52OFAhXE{w`SjQ&y@FAzkLIwZ%AtTeu-ne4`JJ>#&&v&|Gl+w821-Tjgi!Evt zd%b-uo83oY1NyjGmoD+Fq?_AaUTVwD8#VgTa=qbu&)B0_S?4%Y3Y*kDhGllQGf%rH z*0oDxHm5@@3v1(GYr906OK)SZ-x&pJPPV5{q@}#Hy@YSJX~<5*#F#SJOKqZgr7a?n zec3sk&AB7l6G8JBpF1tLWzm$}35Dgn`pxioX6_Q@uE9(hUO2vx4eyY~(oaX5OQS#~ z%2QtI%FQdBGJL{>;Zt(+^UB$z7)-rmWA=XQdaUfuRPM7yB(cKQ>HOX|!{gY9J7ZXO zU$;7S_}IzA^QN#NZR1V#*_@8i>6a>q1NI!TJJ z;o&a++~*PT?A}fdv!acL85)_K5kO3sAb!YLSa%H;f_5t#e9 z{Crw9x|9bg_%0U*xxCbmhJJAUY1Mr@d$N7H*Ar?bXFGZ_OKG1R zZ^75{Qg80W;bTYVj2c}ya&m5gR0QIF41d@O+1%HzGuzQQUFy2ju@P8Dd8yqX2x&BG zUNec@!u*^m`T5Yo+WgL+FqNj2K%Mx#cY9;lD_#7`OP2rqr!_k>{(mFy!{zGh9gUY2{Q%u8IYS%>5X4au=O6p{4>os`M zl6a%F+(n2Kc3bBJm-gXl`jEX@i%AD(5^Aoc<~*R@fHM+q5KLxwbJ^kl8wcEZJk za3Lvc*e$HW~MI&~+gTJ2kx#S|Kh*FO36m&S3G0et zIo)ig_3S{mMEL4xWhh~#wMUH38#!V4RDB-f(IV3{ie2qiU)e})>gm2a!Zd<)>E7J5 zf=%e&(zKPW=$>NAWxKnlr4~^$uc67BUzQBnK!^lZ85P6aJrvVS7Skiuw1&0qk!D)W z9_o><t|E`Hl|9l;%h~=OcParwrjwJ4Di}U;JUFE*?dTAKb?h0TJV{^^ zw2R@dS|i*#r68NxvyH+C*HAjjqdg-{tJwLTO_ehGm_i?2MTMg$>r|(++j=!NZDRv_ zWt!%(g}s_6o2XqH>)JL+r#Y9M>D3_RIrDQ#WMS} zR)$cEX8H~puRK9un_3%Yymc%-N&m$z_lYqTvo(F=S;{^ASXKW7{8we}j;d1|`BiEO z7a7B|9BzZ>OWAw(w6ZQF)O*VdJ`Z`Q=Fnm0qMAKR}q3<|l7LD9W-F&bxs`jlzg%{lg#(8&4iLO8>Bfb?x8Iv>0V7 z>(b7rf933@{w++4*t!0R#pFH%`>7!388|=%xy(Q{733`guTwFfiZ`funTmr{ke>{^ zNktA7ho~SY88}P@xyHa-R8&y$HWlO*14pQ+q~aY*G0NdoeV2;OR2-#(Tw>rD732d0 z$EhIa7dS!1vs9d<;sq++qk_C&;C(8{*9AVHVha_gs36}K_>c;6V}XyTAeU7f_?W8X zsREx+K~5_0DHY_O0-sSqjw$dt6@rS>RFF#woS}j|P~a>T`Ba>vf_zTkJQXEWd_l!B zD!!zG{7c{~Dkc_F`85^msrZHpawCCnsTfbi1u8~SaghpgAc60w7(vDNRIH%l2P(Ew zafymtDt@Gbd`aLk6&t9yLd8rfu3G+6{GY%Ys{Ta9YASxFf}BX;e^fj|#WgCHQ}GKG zr^~R#cxyusra1=@)UtTs8~hCpHz^e2>eCGbSjGfrg9qj9L#Z4;6 zQw08FMKPCZCaRH}2$-ohhH4h7t)!ZjYL8LPMzx((Q>aG1AfQt1DXQ72Hi>Eus#RGg zqI6Pq2z?Br+7ncBQEe>M!l@?36hXBm^vzARsZ{e&?NzFIskW4AKB_IGS|ruxP%VmT zYuWJoA_vVPIF{fSsTN1ISEv?GHL~oY9m1>K2 zoVYK-B27A|nz~+S^+h8^s%%hw=)uU=1d)XW)wd#|B}BFrRAZZI5ZPQ%o%Ca(#F1qM z)lIQU5+d6RsxuGzCG@O>nwlC(h%7It_S>dG+lf~}wdm6fi6j#Ys&_TKO+teu6tLVb zAu`3F>bTiXLa#}v`?5PEL>3uT)rFlUG+RQW#&?wvS!Pg8zoVCg$U1}S?VB`cH@TFc z`flsq5=mwnRJ(oHS3+cFVP zs6KvCgUGal>f1f$%9do_LG_jYJT4(J@u1qHuLeCMq5L5lL`Gj6RIkm~K(hRxx@5fu zk@bU77c_`GKv4ZMa-JkgP9UiMr-=rUBM7Qf=V=f*gPZfl6*x_{dJ`Vk-rG4?$2_7>gUBHU)q0<6 zkY?y_MLsS2kz<4g^?15ig5({8>dsOPNggt&&VNgT$V&#*H^0{)@{~cfm1C*wN8U21 z=CshDwG#SufCep)(CbASM1B;Sa7=^9m%>JVSlYUn{2V#dpc>|8k|;UVpqkx6gUGQ4 z)yORxM9wv+{&rS_$iW8HKN^>LU+p5INeQ+G2_ZEt1fo3JDdJx<-vI7>z_t z-bi-epbjR%77t2fhfAVaa8wH8gVR`5Ad+PcD`fSC_GfPnNn{U>xtE=vn#vjtZ@?~1 zb+A7Nhq1RGbFr;Mqu9lq6jLwu`p|al>M$qE$#F2p@D%p^Gl}e*u|D=#j*~qwKEdN_ z*)jwFqr+OpxX}{|SjN&gc6P9x^~j57&ku|CMb&CBA%E;x9N4qRbOOzIrVMMwo*0_Q z#w@s-70rla&(3$T{ITJt2ScN78xq69Fz-X9-I*;Xj?J5t%wErF#MX~VWWTR)v3?^X z!^-4-vZTCmX=9eXG-_!@3_CPDovki(EnVoTMK_+EAL+4_1$MFY5e-$^XV8bGjP$cP zBkHq7%QY_1>WNE-cpCe5crrUUwjSF!sxdpvqnU>}+301-v~JdVX(BUE>B;UMoA%H7 zvnTSiSlgA6Y{^I$i>XMdJzI?b0()+BB-=VJEIKDAH!pWePEN~$>E&fIvZNVh&5Duo zDhy<^L%H2pVPP}2XvMv3U0x$On}&f5)@@uPIg|AjK6YevgsC-qZd?pIKTc&G$Ha%` zMk1&j*MvP7NRjhAI=VaYSI+mFu}LhlD2nYJ?J+e%?^L#LqJzCz+C$Es_#8DpmMGfB zPA(d8J9}A~{6dd9bKGn?1z~T8;7lRQ5(* zefH(}3~=F5R$bJE-N+65$LIwUn`4~q|B%jm1&!I_0>6}!@>r||=YCeTI-XS(g|qBJ zKP1(J9hmQ7!=|-iNi)J&%Jgvd=TaBjmJ_*ja$1OW#LAo}U2I8SG!lI8O^jqe7DltL zr`I#3G1KHomRR5pP5F^Y?OE{@#Wpd&2noW7qIkA*l80RjCb4eMq_c*3Y0SCU#axr^ z?9Y4`o4-&l+7wT8%;R&JX?il-k6E-XjIxf(EgTODO{Bt*P};6cl|pH-pn;s`cQYa- zwE<(JZc(QESuR%kWIRjHuMfjZ0>NY{B3*dW7_UGvYb)HLNljVVBroeY#I^JZH~VmQ zBk+`hAd=nQsdt-_*zjr5tP3n2wui+NG<0gW5D}8&xmD;K0rR4G2^~x8qgkRdDu3j7 z*zllfEv58-pXp)~rg>P{qYgG>m8@IxN9MAU{O&ph2)h&}7s-y6`xu1B97Qp@km|E% z^PKd}He$-;F@-EWFUdOk(J8Ijx#=U2xqfa;nzV9~Xs0|!$nG{wuMYvlvd)h=uoCZ# z7|WyRTreZq@E{-K~TbE@GwH|EYEC+ix&*elOCx;v-kQo&%*_u^ZET_b;4@My;4R)Zo9wTKT>~u`CFX3zx3rFP_O5SP9r9idTglSNgQ0~5ErX}NCY;j2x z>$WVNT`TD=_W|;R&y_T&HLFBcI42z<+(2DL)OnFjoYn{ zJUlp*Wj^jU{9uZfI?Jf*{wPSsG?CQFej?pIaTGblQf>da^mrt8sv&aL1Dx7WetTngIR0}F4*YPDWYmK1cE+DmB7l1SF5G?JAszLR~mD8)H-;;8YG zsYYW5n>H!j*e7X6EnnO?Ja_VxqTv%p28}ml_POD!K5?_usTXPq#n z+p;(-ZS2f6B*oN(y*@LRU0520VIyraEy<$F$dbd^v6)elUldRM(}j~fH2bASK8;Ql+D=n(UDhAivgTWt1cs zzcN|(h;-5=N+%1N{4-`Vbi%Of-wRx9_3Ar9+lFDnwf+4=tF&Ep>q@`$^K#RZJ0^Tw zA?vbco9QKXdCgJ8(qB~7V`nM{vMu}lY~XVv*u~9$cJ8?x*6um{cca3_uFYZVKhWw| zP>*{N+sGD$x9_JkWUHRfVt;M%FI_j0b=%a0U;bNZ%=WL#VneI_yhW56&RV|kAUh)b zyd+nx&)#_iydCugugq)k;<%_ve=pDF|~CH_Z)CEX3Owl;%-0x z?wBK;#c$4Hm)@X>tNfw6y&nGI5JxoIh_4@R^0TllBUrZsgq^@H9`tih->^39fvs8W zk2})anOOACGQNg@-p`fo)l=1sWaOHi;F! z;pYRM4R65aZ_i@R^?vr<_Hiup6+b_-D!e(Xtjc1gC;i;HDZDMaK2Twt>A-5lz{)*Rt5D zSN(igJ={jO*qz1fFN2%AN3#L1`dQqb2`uZlpKaJPf=yiKXU+HKv%OHR{d)(p(Xab? z#|{w*?7@9mtUtu}>b`vT9vb)AKb#Hz(9e$VpURf)^RuxBig1BQ^Q#^ck;+o4v)GMy z{CsOsL}RuIzz3k_I?u%&2cD;^SyyfT59tQPRZ)CCZt$vgf zmUVD2yK%zL79SkQPDA=(Z%$>M*ZO((*I3ce zes=Zk;cU*Eets$3oypc6$zrj`{7ijkJag>z^W;=_6Sn`IEOz_betx!|JB4+5_ZT~l z$z~iK#qNdaTxsG?XCEKUVxA8m=w_f1IF`lkA`5HbZngAy7MuJISbrjtoj+#fh4O#a9RQ&?xLeb}iywgk-09SBNEA7-(ykN8>fhqJXCk9!p4 zO9dQSU=-CTEgG0aHA;yFW>bxhsey%5qf}_%8LCklH1Gn|C=^u9i0M4 zsYU^R;8Utm1Rwa8YLx8^{7<194+?_=|4~s;NE-;J8pWG|1gcTg7-&Q_N^J&OQ;p)e zKv$|!uomb~HHxbOgQ!MPOkf<nK=feBQjtYct0)gGbRe5x&{8lxIz8UvM7 zqa~!Nn8O6Y5`dCJ_KdCmIYIX+-$|44$ zsYVIJKs~Ba@-UD=HA)-?I#P|2hJoHxql97Lzf_}SVPGWHC{Y+Fpc*9!1GA_`3Bo{e zkg7AN%Be<)!N5AIQBpAQ64fXn7}!s>$Efx$)hH1d_=IYeRQrZ%lmHC;Of^dW1#VJ} z@_qrA6NS9zh^JZ=eQQXy;qu0<6;&zG7s#R-CHVsVs749Cz(A@=F^#3#68biUYLwFp z%%K|P^8$;hM!CGe3aU{aFR+nnl*0?`q#EV#0&h@_a(96fs1*k&aThpEA1P@U_>O9n zuM7N2HOkcmEMX`HQq4oPK~zho8s+B#O{qq?xj;LrQC=?4jcSyW3*3uZQK@xG{>Z}e zS>=rbFVV+du)xx=5k(Uw?D*wVw~237-1S-G&)+b;wBv`*_glHIg}W`U`r38};*11# z`xm|VpDo<=cdY&*%0x9UztUex-SOp@KWX5OufHzUYjeJR&McekX!YG9{o8xrZ`W&2 zU;0j~@q#g`eFwYzjSe2WO|`SdKf8GT1h;F)rmIJ5ec!S8=P&gBCD*R&h~gQlW5?6K zcC%>nN$PHO^L-QD_8ou!UTicOX0`8F_UBd&WF^-e{FuoUu_O2IcXV>yZsu!~C8PlI z6}@ZKdW&5=YcXBc;d7a0J6{&=i{jfXCWY_McZcy$944>$*k*c7Z*zVk+FXe=xp_%} z+a=yqO&{tQ%+<+xxX;H^3f!tV<}iI^V49olVsDsfq&5wa8DZL~qcX=>?c#>pbVi4X zL%hLc@czss5OMiT`YJdLEHLmrIxnv5Qzb7{UNYJ35P?|JlRAy_iD>DJHyzjE{XN3% zJhr7NmREUw4nC~V?G|Z?rcZTr@d|5gbY_Cd$@-?SSF??Hia->LV7aH@*5mO4Uj`Df9ctQ1wyY4WZ(ECWvtj;sVh^!7K zLnYVDgVJPoGDXyyB43q_MvJb2^i;H)g zPTzvr8sm!*jvl77I)xlQ*i`5gB7lzv|5k8h~$|$C<+QrDc9$EbYZ7V1x?;rcd;i#-by6+xskDv1>vd ztrE~GgZGl=@dA_Y7Rkz4XFUnRX@v$~xik^X%W+HdlMCE2B6nKIuxkVajDxR!6wH77 zl*uP5rkf7w)2vxQ)tE+bhBHFFjRimtf{@G3S#@|Oz%!3N1H(*W#gB7L`d-1wS@2o= zU>4!?Oc!g9cFz+g4~PBvM34D(=W(Lc?G^VdFrC+%OTu}ja9lUid)z|<& zD*VL;@N-9A$I@TfXgaJ@3(1O88?k+}>3bbRPN$+5=6iLSJ6>bi&s+b+zR=Gmu5JsB zY8X!pQM6TXcO;+j7Y1$nQeBA?mX~mBq#bsI95U&o$l4iF1MFuB{3?eES3Z_x6%UJ= z#TrT`hvBJ>ec}8_7~Is{*Z###?XM5VU%IDGZvhqkQ(vsymS#6K`*`*^la=>*)*Yca zy~77gZ|ZI2W^v$Iw?}}9?;HG6;6$WYfx#@Bz{h-i&=^O+l8pV#;B+i++0^IdYg$_2 zbKW+n3sCp!s&e%X>~!%*L;hYGYQ|BpYx^pVsA1s~)@I2;o+i`wKj^Cj^a zAA$PjlOgKG@0(Pey4**x8yfqnRQ|mmnaqavh8SDb+~*TFKQSCGPul~#{^5Vn>zkjM zzBU*@9zOLsNV!uxjM?^#$%yPUZ*|TXNMIR;xyltS{LSpHqeO-S{Tgsudm9lUiI2)+EnzbNs^ zb$HKsMX*I4z(GeQ)MhE}K7$%e z){BT;E4^kTLX)yhYXcX!G16=Vw4r@ZR7IPw{!<9zM6CIWv9v>`1pdw|aZu)X^GWTa z08Jypb*DqgE+?BW>Fs5N3#Ie%({15u4!6aAK20t+!b{E;@!oLA>Jm#&rZB;I{OYisI(xLY<{c zW+99#Zew=vtC?mGf2NJuC)#G1jgT39{oCLK3Hd^%IYGEvnIEdvU7-6xy^)l|s+~BT zRJJvTiIR2(&v-Sui`+ZR0ljB_K4g2TgIPZjayr(CS2~&X09YVG*AIIf)kN`PSF^Dh zNqEiO=EnLt=VrOf&1VW6#a>+j-(u-$o?XM#Sh1;B4JDr?R=nKDY{b%1TA8<5+lndLbn-d1!5TamGNPI`p3c5F{>%b6p>_|2tgp`45xoD%B$w#) zh}k$m{sVn-w>w-LVeFt=r^bhM@mcwj?-IgA{*aJSNGJ61edc&VM~THbA>z{aV@<|3 z=oaQ!Q906V#2Ph&U(NDG@PfVWaB+Ne-R}FwnhkFUKNHK*GG6?Z8?p@Oe=N`H>Wk)m z_F(1l6U_QqP2gB-1RHc5=b7!m$CF)gmbj50G9RK@G1aW@njBgW`pHkiJ|(1uA%X9j zYG@jVHQV|5t!6jRJ^*WtdbAEv;eO1p8!l~a!UEXI%>(WvUi1*+hzDny_v-2auZ}qM z0M02n)riRZ&JGPr4C4b{$Iid48oU`;QfCN>5ku#ije{KN9f#hz2@}P^C9imDo_V)E zPR)c}-F;p$bH4dw9V0zICir`;8Hq(fvwq?dV6x%t;REcvWh1ci{2T5Fv3ariSnW=0 z%0fm{Gn->Qpci|W)@jM(dio;y&_kHwhvnw|It>gIC-zpDjX1p$hR3({MCL=<*o9}z zM#@04rs_@Xs}l3evvn}y^h)zrwdZwVwZS^1YV3SNU$a|$SsBtIa>snwF>vn0Aq4o- z%`oWS*P4ygOi28EXm6iKe80|YY~rLW;?wmZ&p_%Z&TI?~Uc&@@4C85=%?|O`X7juH z+(;w>I`m_$x$>vpLQG)aUZ;^%H1TJZArg*&&d#rXgBcIJ#}_M-c9@NrvBn`xf7=}= zTJAK|Nq}dDgo&{t^EI=6S{2YiV`~bjiRiS?Y#cgiojkRlFI@CFU^YT9DV;9wxP2n~ z^|~Lo_JhczaK|33qvztDL!l)|)9upV7cByB)zJ-+bEHlqk^62)$K}QeNnOx6roksd zrY`67;s8Tqmc3V3FJ^ua+9VB+>lS4nhD?Cu@%I1vY&(Zpj9i#>5%?A(V9!QeCk?c~YB7S|8at{y z<&M<^zFx5yF(~a1qRehF9FnvHz^Yi|v=|l#or~ku5BuzV?_1G!vDszOBR(#Ly- zM)&;~?GhrQ&OA6U(fs0C=*uaOWskN}0cu8QDM#D)5%y&J1T^|6%3{Pa#+Ksd5g)sg zdE<*f{~Tj6BI}Tj@Jo*%D3EGwjkoO3nMuiWaWcVTq^FII*i-QdlwR%|zGRCLz!P=@ z!WTUP3)u}%8-%l9d@6ipw{%OL-OTeTTv!Kxh(k5=**C}+C;Bz87`Z-@tH6F@ggnxr z-r2-rY)yuGdc>X0EJpk#cg*6?a58ye2tw8oEi6WYR(8+IsMB3QIgC6}NU=p$D~l1< z8)LZn^&vQ>Nbf(Qjm5~M%Va*H2jl9Y#@^FT<5>0J9d(w8jIQN>I-jL8LL-I0a~dWv zv6IEfoY$eD@IVd@8q>O1R%kpH{<|z(r-AIVoj3X~nEdtKmgn`4Sf*W6b`NQ>oZ_0E z79$HQjR|n1sOlZkUFldh-D5HGdvvG}@Ak8V)e@|@GQeUuB9gms-DmkrA5_j6Gx6~o z=MkwRZ-+4E0gJIo8e{tSurCm?Nc8>xwS=M%y57K)eSGx@gs~d>VT)Z4##eo7bBh^+ zEG7D2i$^0F9yP?WR)_Q61$<(t#R%SI``8hdc^Y199cj_iz5-p16IcFN%VvFb_bfrQ zA2G+Gh%Nz(9_WkX<1Mf11K>mxBVL>s(i{nI$*%+RqhBLKA`fSWCs_>FL^my*&$2{_ zb%hq=TqaGdtSF?{AQvxIPphMIqHMaw*!iV@1CeO4WrjgSpi_>J`l%Lq|iZW*M{gIK`90!8bSlj{o; zE^evRN0V_zkHsJfj8mL>Ce)D@z{gy2`}wY=7UXYMSf17U$P>jKt1MHsAw=~WixG*D zc8bd9Ed33Jtusav&`jglD|z?YR!gGTw$Tzw)sv#H-)yO~o*xKVoJK*;*!bzk}G79;A_^zWd>h?As;C_7{^jzrRfu(v`yD8^-{ zSa`&6Wdior(NGwilf^s7Ev32;aE`W%{F5P`%H%}%U)<4r&-R!kK6n%k)8+45QuOZf zI`Ok#a86#f9drKQhn6Bk1Lim!e464(7HdAX9MnH%6@=Txj883%buB_>y9J+l9g*zs zpIeL==~dX ziLf@{X(MA1!hU0kuGLY1`aL?_{Du?ysCu-Pe83cJd&e)pBlq~;@W7(eCClAm-9ewfEDiJlst-fT3vO7N=EY@B%3W_%R**iP?x{!d(|o_APp*I}80 zYv!^VvLI#)FuO;s_IT0<=4ZRCDnF@sB6y|h@rWi~t6_F2<=`V$bvr+)dSb+kNUL!O zJ^l=+Er_=2+ohHy>KJD=f;`H9@u`Z(!%JrRd=*YlIN#9O<`tt7tktzWNv9<1!@8EP z{u0|mg$vVo>?Ma!e3)u2)LTl=3`~-km2Nd+0+~d=$8XhBi~^FYy;RaG2VdjzMDon0 zRvSOx(0aRwYiu>FGxH8>6W(DR*x9eC)i7?N$w4!nS4DWNykK3dTTE+i)q@`C#wWD2 z8oM{8UBu!{tFe2ZcoW8SuC+CduUZ=$B`(}BbgBl#)=h+rqHqBp0Ybi<}DM*JWHMX*?7ggD#P z+CpQtz-tS?-iN${$mwZargIyyn2Yz0@+6Apy+ho_l^3!$eXKY1MskOX?q}_()0>!W zU7?}m>3;q^98cQbXEk=3E(dHrUJ&aE6V?Z;#)($jWMVzh!uj72t7M2XaFWeQ&AlS& zVXKiTmM3+`Kx-&uzG>BH^535Dg|k)HyyEV`p$TKBgz6IUhC{8rw51BT*q8JLkPGF* zUcxvf@g7AyGQw&EhSD!*jj|dCbNKbqI;&*rbK5wpaR$H*NTR3=SPh5fxoJ)0RS6z9 zU-2qZ@E=bI*@JxSa3Iebr&C&!4^Mfuz?!VX@{Z@pY1U|dV}Y-p7*c38jz`pzqh&Nd zo8<9xV7%gmqL2p2V@O#)TO>c1;&Jf(Pa%9x%!Q@BIn8S1IB1$0+8xA=&qvb@jiw7{ z1M_UWPwVKMX*G@pQhz!((1^$J?@wdwMze3BtMI{Vb+uYm4TVl|FHQodMIoai{$ zuse}C&uUy$;be!`7W1t}tS*%#JBT=Z%7Tzd%7f8?QJ6yh0+_Muc}!EzXu%5eVgyv}MI{9xm0ysFHX!ZAVIv#t-B1ZIhcuZ`h=j*oz9ZP{owqB)s* zzVe_gmJfRx$NW8;tsm+J2974uN+Nhw6ByXZt;U);QLESng`OQ{^9kqnx?Ig(>Pr+! zFNM5B&1y?FTAdXPXZ(a*^y{_5YMk*4hS^fNj`i_{cVdb~JO5?D)P%Qa?s14>Va!J4 zzZP<~#S35!*>6}A_^?X}s`zA&)wsy0kqx26&3#tmI4k>9miy{yTG^vIB!~X1utj!y z!`jl2FJ2MwX|Excsy>Jy;}}s0s|umF-$&En@oPD$0<4<3CXEunk5_K z?T8bt#<}?H7DO`z$E-%=M!|<1Qk*?uHBuUewZ!u5cdfW>ZUrT|av;nr8ozHf&ioXW z@XOsGR;z{@rQZTQQVKAxDKFj>k3-`}*7Lg5>oCgAt6L)ikmf2rF>H-X z%>WjpeZlt5f{lzuVTrkFIe>> zr2xi=_V=w*QL5D33NCw_|Y06MqUnaNV2VDC2m3CREz+jMkcaP z%MKowM)J_lw|F_2{VLqRe17d;OvJMq2m9hx$acx666*E3Os`($i_%Ou>Gx0^X6(4J z9KBr}ChQeW{fX_#rb#rDs=CYCQ*gUgCao6S&0Y#E6h9aVlpu|;saLOiWuMM_nCgs5s_GmasosRDbg5%kvZG@>`+p6a4FMcil+ zB2=RjKu3wB%(_e~!AIV^2tn;#x7%uKoPfsN)H$iif4wh8CvW1KF zoo$9|!?u;mvp4x1;y{+oIKKt0 zxG^8R>D-2y|2C$Md)bw1Gj=)2o9h3o2?$xNyu)?` zAqDxi_Y5aUsV$sJjI)OfRjW^1!+FZX2ySK<+Kf|*yek@CWHT}u6a{cZ0kNWLT1aqG zqdfx=yk+!HcJkB3@MzY@Y{s#|K*tEzOq&tp;#lV6)l~@D+_P;)XfqN&5bm}+`0yEO%60fbZZ87wtO#jIDzF_leTldcOHY1}(CmoKH4rYXo z)W$BhZ?xU3krdu7w!JzbQY>+GYsgY-)>1tR$Ke~>Y`yh)$Q&RJu)AxCzG5yGoi!GE zb?jAa<#&`|D<8eXXd<9O|CFNMe8_9KR39Tkn=ze%InKa3x@rv0BJGxAyPWb`XsV=Z zp#jCvJvJlpE)$*LzkaR|Sd(s*BJ1@KhmDoRh#?1UGjvXTcgQxu#Cr{l$j8rO>+x^j zvi0IEhDUh0r;idT?t9x7Wg^(eul83`M8y%?FB&XXy=z;gqpBZqsl3q%Tbvkw%=WyF zPdj15F;jNUin6Ps`Fplr77gw)+!eux1R&7LQ?@yJqa}s7V7&7q+kPF+d=lCE3;TSr zJYhWIW%wQB9zU_+=0(!kc4V}Cmzo9{F%I+Y}w+P4aZlF{ta6Lz9uEXElPhSqm>^^R#;Ur z`!`#H-e|xoyUMTMu%(KVe~|2Cqm%cU)eUF=!hRuXUcEu_ki>XeV)UUlC53OF47}$~OI@F$3ABfhM<0sS09QIYh|< zEZ{`C0{sjP38${e<~Z~i&j`t~5M5OYzYJag6Al z;1WX`-?Ci2_thC5C*Qji`LQRODv0Fd1Pn=QZSc-f`N|j@Q{|XyJ+Z2#a!vnuZi|Y0 zvrOeNokay!r(}^!WVcqz^hS_$B(I*0Z6u|wf-OJ}glXb3V|;>Lgtb?6HRe?_9jf^4 z4h7LMH4?EM75o4~wkJjkh!TlUi9-La8meL${07A06b(ic9prS6QgF;f5hw`Ida8kx0H@ z*{Nd=Kd!Xmo(~f|0>1)6E=!WE|B!+!3953~c$g@7L_wlm!e>5FRbKWoqD2R3?k()WnZF;B7&(OZ?q^|+b`79wyEE=J}MaWJt;#PdvM+sK3eH6)8 zemwCEeDvNiN*ld0Fi|x}LA*yF1w=X5qT|UTq$XrO1)9ZA zDvR`<(BLpqf(V|;Jc<0n_ux)OJ*BMH(co1)VQ>TXW1?=TqZX2>$Z;W4iEhQgJFnQV zNcm912rx$%m-z5$rM*5SNX`(V(X}3TeS#lIfD2x6u)^ri(Z2)#kt<#f2Ka=1Ik{{( zCTMivH!deeb1(o-X9YPOiIIkzu}Z=3t0bJf3xXfGMp>wFL0n&}V2hS0>GF=OQxM@9 zM6r-(J?;2AFN0{)4dn7AMw9YqzSiQQO$u@c@}uXzFjd^MMJd)O*D*AedsgBQcBl$; zeA|^NdKdT~ozc}RJ(1$gDrJX`Arlg0Li)66lM#DgA$KeXt1QJ1aBi2fS%>8gAcdKI z1}C{auPIOKl$a#g>PNEhm`2Kd&2UUu4};??T5Q5&Owr|WWUnLL{&W^ z`1pW=qr8Nr6P2T+ox>a5_%}#pBu1)ChtCu@AGQYfVpl408F=X+Z8j23=Eh-ecwKqU z=jRzilkDQVLkccXB>LVxXG${x#ok_fh?3JvgNpS@D!+IL>hOxnK4Dg!VLQBj7ENt*tvtf#&n|X~msaUf0Q! z|K#wW(2}o}+eFJR6$F)%$c?X*);baCI)J~OFZo7s@I6a$1N!{829Ly|iwf5$^BO6g z-vlQ!_>zKG0dgWWQaZQAlOS4NR`5PXVn_l462Ng=!jk3a?&4`%J+XY^H^vI5{roS? zHySq6nE%Q(ii0GbobLFY@=e;X3brD4?RQ;SppSSy69Mk!-zY+oEl?)4Ll4$8gC>}6vd6@&Vbt$S(yy8@mJ(PrS;r^~p=;}O}KWuiA^Bf7UpQ{N`0LZNR!6b&OOISp$yZ=YLdPd}4Q)bWXGi z6OxT&#BYmL;kmR(ssXyyIWw5%x9mt(*qhjZf-RYyiMsviwLVFoBQ1>#&Tu zKk20YX29SO2Z!wZcn39B*t1mFs_a>_4#My*SCBZ0yGw1Ou}(mVH{H@QqPLpFpBV~W zd8nsaVGKdbR(h+0WY1cH<~Q~rl?e5R-|eeT*PF{TW20=LGQ5{!yA3#M4*rDbKM|1w02lR&jB#il7wT zqmXk`kzc5xRPnPf1=%-snm&i*?zp8xPgO*WROe|e#kx@{GR(4*jAS1jqau>M_pk7L z`fEiK__3SedL-%zkSPGxP2qv@D$cnCSG<65boO@DDT*eNCCD~a3)N`;$N!L@zB6Cl zs5gX~@Cnn@2tvebPpeu@QrnufF3=~HKRE+pU0z7Sl61;usj0m58X}3JAQH&Sid6Vj zIV$NKi2b5BESZ6Z6AyYKMCEi+Cu$?`@rGUnA)MPKO(`-Alpqcis~_thC8M{`QGe87 zEFe`Jdz>svc9QCfPH`27J*qhM1R0b>kkRtLcELTKq|r}4sh-p^CC#zktIWW>_mp}} z!w3+Et^7-O9{(F&@10#lQj_SsY)B2vMJ}vNop1CZYfoOPA}b^t(Le$NtuphK8^iGz zL82n=qIp9O$F^Woczv;ylOR#mUGYcHkcCS)Z%DYC2J`T;cc5JE6>3m# zDRW!+yJC&Rrz=$)=VWvF01F@SuNM7|r&_;SU0$KAQ4vf@G`%Yle^jbCVn|rJaHBc4 z-L-JkAN~R3t9YImBirCQFO#491Nl#!m*F|&N13*j9lQK#>|qx-sMR_eDMvdkw1v35 zNkuq9eFO-VShQ;XcC||Xn)wo$q$Dbz%VDi4C!Z;Uo`<*i8$XwlSGf1@ zRB_;x9pwW^$oqLS-_XgeC1tADr}9?2!QrfIobY5)X3cJ5Ghp3bzS=`u2f^a%KJ|GW zCAI3nZ#c>o9LJXQ&H?GryoK$-l&wS65BKE$n;{6g~Dk^a%===q={bV(4?(>7{ zcRJmV4yh?-t+$LV!{1hMW{}iqXXe!(q0_JrAlZKJke9DZ4G6a=IBFo|aha>1>s`3} zja2+eld)j!=Hn`^wluOx>eOm8@f6~Ns*@y5iIzTDlE`{JRS|pMCy`1_p#a!l299M4Ff(#a^cUvp>Fq|QTOR2t{wqjPP7HXz{)6I zW{ytI=Z7x9UsU zN0EI|Mc58}6welTq0%qT9wyKTuV7^-h%}yOe-76E`D2KZA>0VQE}JK3m4Wzx>z z#x3a^NbISLAavmmvRPvQ4s5c(2pP4Bmz?p~cJ{C@u0@-Jb_CB*BRwL_Y`;}8(Z$L$ zf#yFbk@`^4R(tKCj3)8giW(~Rv|9u)>>QRg)nR{99~uIP=G)ZBNYO4VG%5rDLpp~e zyw&`e;Ktq6IndfY)3RyPDdO`X*2YTf3Usv2hV7a4rkz4cB~$WYvv*@Fr>BLKWNJ zX2(7+Nyx3JZKgefmwk&1nW(0A{1CTQh@|dP!ua{y?Oxuwb(&9O^KY%~*lr~SGA{x1 z!X6`ML3uF@<>VKh$4P199rgmfVaweJJ=JSJe>V}91vjxbQda$$QfV&;dxz>y)cn|-p5$$AYr&eh%R2m`g2 zbV@zb&z{6reTU=Gfu8o08b-2hV{bds#9g@A}c>6PF&c!-L57GSXf6h#ecDZ2#yWJDw-YYUL0+{D^EN zt#!i?dp+J_Qd)$TAGQv&<5(=w=+s1bM%ZuaunZv^k0MzUUIty@h*RtxYoD#RNp1xh z-JffJS%+n;pEBOg^&w?2fldx_cA~vRYlI6>`%b;RybtL-iP|5&fDn-WnkfD{XnmeH z#omjrxrpfDvneDbRK4P6k-ffIR=EruKL5n-;U~A+t^64;Vz1ms?T>0LwLc|u^Cb-( z%ikQ1b8oB1?9b_Fc>|fV(cYM+U4spk{SQ}L@1BN+ww-B5ltqJayq3jpBxaL%BrG3l zFFCD|jN|)XNQ)9rme`S`lXJsM?WTH5`O0a-1-+&CVV==QzVy8`-;R{0BuS69`T0Wz z$&=R+%?)_Uj%2As2CBcONd0yX?>biY+GbU zI4RMXP$th3j5cmf3O7PH2HQ^d0nR$Z{c0=uG}&N@SdXED@Nc^m{>#62%>Inj^e-&8-Ft=#abt~fye!PCi?is1I^yIIr#`g-=hJX6 z_@TX%E?xY#$}Qj}*6Jh5$1$+XX1rAxQvDx%W=B{o7a{*P6Rg`XO?o&j_MWvPc_;C- z3IT;Q^jZESCF3hQp4~`1p77zv=NIg^ak119BQ}3yM~|e2xGt5{@f#Dn2wt}1M;M{mka2VyQ^oj}p3t5kRzKOXu7bU;guhwD!2LqaOe8k^Wi1DhLRep5cj)+z+W#8}i zX8H^aZ>TjFZT_-f)(IJdC-L5%bX{UgZ`hHbA{sl#IQHly8aF)l4xwy5|qci>dp=qznbib<_8kJ;r!wL zhzdT5rFm*?@Sun%)^jxAU6Q;u@p-%h(UOM2%eD>gCK|-(*JXTmdxuMa*sppU=>u-2 zIxNPB^gIdF5C}>dv>=WJxwxlII^xO(#4m}FzhJ}CT)aBPYvmDXP^mGE97yI!v^+&) zr8>HEniu!%O&p)$S+dfh3*~%$uObS2IB=fOW}rBn{I}kYG|{G)1F5Kg@CeOq zysAwkeos3$T@`749M~{r8~M{8SKk^vpuax{-Er}nK4%(w@oW744s0s2k7UHJy&d>d z=Z~jbd1VO{BtP4MZA+r%i_9AI4|CJQdEzJ}wl>`7z@~UB35R&`0SA&n64QA&emn(v zg^2+VIgt95ALU=>`Qc&5E*+M?Y}q}~vC_=_y_F*R8}4KI&E86V@!z3jqp0dO`fQE^ zDG3dxzeT!wB`8-9cVN$zAJ5N$zzSM;BYDMFkQE#0sL(M|k;P0$su(`nfs>SME`OOx zA9-r~NR=mD#T|QatOF68M9T+UdASZeB$hDVm`dtVh&j@|{OEd^@Tu_*q!uKaj6rOl z=s*TT!g!d8zwVcBbf@5r%NckkI}jkrHuATk5mQKD5|)PC6h}*ANZ5_I=TQeeR3R?N zZDaOhjx-&X(!mt*XH7G`(E@*A3rA$xQd$b}ho8LNYZbjq$m9tlz$Bc%Wh3dx-g=xg zR>D$)KYk)K9fLe_UmYWx@LoZzxcvh1gOU;$g7k;%DLnxeFNaGM14|v){UwIjz`+I$ z!@qCk4dZ|3gAiNnct>j^S%Yb$@~S0ZapxByyWM5v8zlwl^1viXAqo#zBAtByZtO|N zmO2jUZOF%pE#-9?b++ObM(H%NpK(NqKFb}gHEs#mBJ4~XjowsduXY^OVQC*zS2(;C z9liL0dxLro9vF@3Pp%A2ux9bq?Y*h|(Xp8SlWQGFDoKhmx}3PqfooL>*Kjra4sR0y zJwhxeF*3T`z0rXamxS>HJ={)qjr8+XouHtSZT>CB)OLYSdP8aW&9>uDsA(N#Y!5xc z&u}Uoabm(tv+P<7w%K=B1HQq7Yca(e%SB217yFb>h^oFniNLD`BvO& zN&PJ89_bQI4?4=VmI8~0k;_K7PP6lm-*mL*IY%5eezr@!2%a<;*To&)qWw{}!GiE` zx_e|Nj@vb_n0Lf6S|37QoM|SI<#mYUqmCgazRi!@GyFRcx%}M*#--WR<1|gc`Z<30 z3CB+wEFaS(_wlOY{r4O=w4zOv81(_UF4_G2%Q$De)fFL^{AJyU4;`=R7@5B~+|}#m zZ}-5_X6j3LnK$BN2hwxYQ8f6}vDB>5=!?HUAU^rrG1A0aeS{Z=b^cun{?QpnFRpwX zQD5A3mS%~n&dmAe90&>|EaTMeUpNqrN|d-*i`Nzqc9CpS_R-#mf9JrT)RnN*;)F{MJYJEoj95c7MBZh`5FH~QXaCyM z+fw*`a%|Vh$>Z>6KRZhGM#XKN4#bZnYDrF-8K&&xM|yh`MD=wNfyBst5;E{SF?Lyja|X};0Jpj_=j}E* z!BfDxgPteu<(8W~NUPW(A_oE8^HI}sshtE9JwXZ_B2{#p!P;w*~B zd(9oOPPkDGy#e|>dphoi(A&$;4e@B~y`NOU3?kR&9tWbYH% zUi@g9(7z{#=2vzM9FpkH_hKjbGZC)TmgW?CZ)r9ydSVvTMqEyJ!p=i87nnJ62^!o5 ze=N6gQ)e>Y-`uZ{)2g8pyK$)bhKR=Sqy&nzrcOMalbDjWSpC)ey{Q6o(^)TuwRB<+ z4)xSnv?l{BnodtzcV;@F$Pz76PP1-zp3~u)882z;#4FR*PNYcWm>39G0=XJ(tV|aN?swwPQAiABo%zj~n19N{*itec za?a8F)T}IGh&M)Dc-V;(z3fvnL5Zmz7}E8cE z?5=*77%<{r20u5{ix&W+Lf%7qi!OOi{PDsZuS@(sI>Z?H)|Nbhp|kYb6n@6ejpn!< z8}3JTxh)dv4+KIgQ8R1V&@(79O!GpcCOCI%Yutt*Ek!-zX5H3ZemIMo&P4$K4 zB!$KB#YN6=@m--4*?GBIC>8!(YEj7AYJ`H131ZeRJeGQ?OE1XgMz_7?LfuAabJSllEw8XRIfHz9}1GpnsgfDuXH-ZuvJc+*=p!s4j|T)zkYapO`RENbgvALjN}k9>io< zDyAaBcX3Y`JVma@0qx>$3`nMK-+`xF`@*ozVkn0Puly0FP~}v(!+5{(8y&J@72Fuh zp)l-z1SW^S(_ab028%25+o`;oZaxzhhDPg9<*N|XvcqB6;W3JEQndN6h2aFXCr`*X zqU%Sn4(0y@+y32Aq3aAD6>Cn^9yt-VM6b@TbtS~%P~xbWFovPkVTW`G`_8rmK(Z!a zBW^o|QR?~~sMY&-7`%C=R@B}Ss#)F)g9pX=;{IU{E#tJ%4$kvFfX<-fOe1z8o=X<| z1mUcE$A=@TiBAg9{(N7|KCb9xD}9pc)Q+C{f7k*ARn$8-~(<+PRUTn$6+bDh~T$JYNI|4tI*MTV~u4QH(g*5sCcp(uC@6*>=hl% zaX#)NAWh}iXI&D`f@n;`J_TDCZr3YOU`9|kmm!U{*Mx;;f3~Z@&tARR@a!APfMG?#^@K0O+^EuXzGX?4LKq8p9;`TQZ;KB*lr^ zct!ZzFg%g{&ZC0-;hP73X1tDlGYqe$WhF&v`1m#qkEpGc-3r6kU6>F@MZJXL7r;m3 ztz45fZv4;VpM+Mfm!jB-V(l}gXb;WD84#0 z!p~Irs@n{Yo00i*LEv(`PUmot`Ls?40dQ=ga*|@Sst_|A4#pQBK+<-FnKN~YfmZVn z{coY&T%k)Fv!TA$Ry89m#kCBzQ!AduWcZ_w8IFW(UVIA#lL7m%XPph@AX_5M|D$jf zGqJwJ%}Fv#!8C|A>l05yQ#e26X+^`FGiDL*J3t&uA;ZNilIoivrr#a6GfW#<-~5Qq zbl(Z)M11cYgM7K68F8V1)B&Wfwzshv{w6~ZmyZ$Xc$0e;H1|XkpLRv3!l`B%lm|`V zP8Up>rl6PXzA$HY3iX49Tfiue$(7H@mRT&%OgpKXK# z4`+k1`PI+f<}H5I=n8h;xK42a<$r1Hybty@W3fSA-+%qLpBb-ah`iPzM{vb|ao`%; zM8@j&BVKrm9ANHF-R5Ci9V>zXPY*H=@Ryk14mBg>%$W9*c&n-9oJgi1|m|9sV^y_;`Fw8K+fLv`#zIWH;^D#Z#+E4db^NwW2eW6fAy z1&-Elf*6s`S3-+CH${%5Re1g{H=E}siOwRgcUEMBlZWkrklekXd1L- zaG`m&4u-phPo+=C;snTky-@f!JI)kgjF|*`ekZo#bpVin)!;&GYeLAe&>W;am}$n@ z1TMtBB!uEyTY^Mmv6L~>9H@1iZAL6ifZ5SuR_d)s+++RYX2d-NKx;P7j9n&^fX8H` z7Ej?PrBt=hqw_EfZ5EiZ`C_nWRztG}8~j+m?jlc~-+((i4rc;E!)0{fHprdXh#lv< z&zKR(U`pKcw>M&ozq}*fvODsu`LGUQ$8m|}Lp`ogUZ8v``Noo+0p_S}~o~wspvhOzIJTF)GN@Che zu(C_{8TvtDKS|#lGDm3btIQj84m19Scz!%!#(InDIGp^7Iaa%W$P9m9_q*mSUGTgMwR~z0uh;|MfFpuyJ}|?P;$}T_LUb>R zp1Wm<(dL~Mi|GFc{$Yc{_zZD0(n7BoAYxR@HQ&7bhHqZ^k8eKwYu|j-H@^A0-x)Ja!=bfJ zIv0>P97W~=a~S7CZo@44*La3cyfbk4Co`VUFpk%*2}D}83PX5j6;?352Wa9iV(n%` zQLo}B7=iRMHAXA>)qGh8h;SZ7-Zn>T%YQfb(-j^J#gOAKbAT55x4Bfu1Z(hi9zb)B z-7{C}g%FLMM!kYZ^Q%mjFm2@nu^<~lln@ONoc7~FMDgrY^dpROO@IYk4laZS+i78Y zi$mKLWO-c{YI8y?@p>n9-Z8}OaqO&Mjf$v>hCuG)Dh`+a5@s!7GlUnF7^<=Pqlo>Vl3_%XM0exrO%zaBMu@ z0#8bSue5D!*T9cq_k_{aioz|10s4Qska-lI`^iWPq6W+!n>|ktwR6!HeTXV1OYt}< z{TSr@_(X&cf30hQ*Ua^V#nNE0;4E@paHfGXY{58hs0c2;slfKWUww;VwmISgV~o%U zV|uM5vr$Q^o%Xkk52mACg~QXxf`?$T30QT4RS%Mq6o}g1WDDFm*`j!*d3RF_cA)=@ z9<9|hw;0BVN35(pX79O^P75tKkJxe3RG+R9x)x20W9!g3NNdv4kPC^PX;{>;SLb#N z2}V=h70Fg@T3d^5X0_t>mU=ppVHAVuK{`$lR(G`gptCKGW7F*k2vPt7E8W@hZ7mT? zJ{%dApu^oPS0z9L|HjH@EF94!a42IvW+DzA;B(+TEXLC1)xi7dmMAUbVGDLA%sMa9 z&=-8qLe!rBh{a69$3g0|ds^Prag4Q7Z{b+S#t!Y-UOuBq7)>2qvO&ds>SMXC*XDVS zLD9k1PK_gQO^e0jC5Rw7+!OA6BsJfthH5`#dFBNl68|mT5>KN#VG#bvu{8Og8Qpu3 z4n00M3_Xk8q(*Ds4>jbX!2lTRiLoSv2uueZ*n}-H ze`7jugvBt7VhA<3EV{MQ@Vd=Xr{h@5UZY|3O%tw{t^#79cVM7p_V8qb z5I^}64v+R&p+)xqspx$iiZxHO?9_?zYJ6r6f?k)3EFN1Y-m&{&y5+WxBo4gN={e}{ zhBMe6-I?jJQM_8;Is=dIn^``E8ffZjMZ9Wq_5EjYIORW&`(To2ox;vx6L@Lf|BeIY zoP(Fpa6TRu_gH9|qH`ohL_1w-Ii%+~gbx=kn9h`9MDn-dApY(rEjTSGr|db=fl}xr zAU49+hVg>%(>^00okmext6J=tld|WcV$D`HOsigEF;*biDIJ3M43>Iq=|3RHms=Ld zq0#W1aE6H{-LMwvx6aq4eyc5bgX2q_W;(Lkg1rU)>QTFU&sng5i@b*CxX4$4;EQ*d%1cjZ{`z#EEgy zK0kJ?d|S->JuqhRJJcYp%{H;XF_^y~_Q^{YJmcUzKe|4;!&0DE=k2Af+!Car`f44C zPhfq&R}4K@;&T)4?ziC6<(wZS-uUE7{SH~y7)XNqKVB9#gOT`v#-&#+_<#lH4Mwe0 z`58{D@rSdYJYt!xqw^Pqetq4NM04N8d%4Lb_#78t~D)Xlk$$0Sp} zvTV@{#qN<%h;z)>u;X~-rUkJ|M&}8}khJSK1##zY(8WPK<; zSX+0?0w>PfTJT*?8Pwm0VA zEO-ng^1^CrQ~oprsX>r%&KZ+sc;%k(f;f+torASM9$1QX4)H>cO>_HO%XIuQynsN1 zzjj7znSoY##2z99A|W*LYsBE{23rwYWC#n1(PKibFd1BU`-~V@vlT}RzWW@}7q`_q zosNEiD1V&I3O&GI-Cm5bTfrFTd0H$OX~mh?^d{Q0eCj~7HA!!h1O2z^TH)j} zoa4IlTY_-WxA5|&y#oJXyp;gK14rL;c!Q}d8DRJ-)B z^+Q=*gWbZRd9LZzh83Ng)TOx3aT@25-d1ce8O&!=z?abwe_FbDyd0(oN_ZU`HPNOTH8D;jJTkp!HDnETjfU_k<+Y=wc+{JLwcdXelo?EH?eEbPHe5X zqq<_^K>c`YEIoL>NszW+tQB^Up?okL-Hz0|z^@`eTMb>1hr==;7Oq}ejpHAAaZr85 zWrcBL8XTnsL&;>jha(o}1_Iov&;V1?tswV_s#nxoVT$At3+lXgO3wD$0m)=LtC4|iK}B8ic7 z!P_apUuhtvvVO5=VtYxTop5d463^t|k2x-1YQ<-=1RW1U#E9=Nw=UKj;Hv=8CtPN- z%8K|Ox5@$UdaJFl^PJ}s)i8>7nsyqd?}s4lP#dnX;`~v_CAe;9_P3-q71myK=Nf#a zf`ND+a7%^tRnu5)C|Q^KQPo*nJIe91ccAQb)~Qr|K@XMVm3QlDT2T=!p=-XYN~SIw zKqvlSu#7L$&JDo$@&g=ozp~N#7>&dRQU;!9ZL-FiL>?dS*lcy_f8)1UC+mOLz33^8 z*yj2B+)LKEIzsFYD;CWL9qiL6Y?rl!f;-xiXzwnx_e346D`+o_e%Nhw(X<33wEy@X zYo4FTE85rltTRotsEP5lsb+_g=}r}R&uxk?O$|R_O*4tVPHn?M>k9c-c#-e`U$!pN zK_9+i9k2iGb=dlx{`Ut>te0GO`4JCp+%YSj7YrGRIQ)|1Sn<*h8tzZM6V@hpbxd63 zkbBZPPyhRMwRM(>eoBPo%l>WMOK;YmW9=sMn&Um|FddYC(^^-nc;DLBL~F}2`~zR9PczSe z#{3F+?bpr-8u;s^CReQWwD@y^2Is3US`)OD=dGP&zT!HX`0oWlC$JeLe&8ePNZQxZ z5O&Lt1tH{hW~P542yq_F#B0|tTD!}<*7`H+2>tJt&#eZAo-7BrDpG;}ae{v{^&>Q%v)01%{bDqg}{aKLb zJd@w{3p#5WMtA>f{bEhPr6ldnuONVb`XHwMj{2PCG2HYAs*5ZSVc=gvQVXnhW@rjI zRO9vg?0bR@3D$*R8>A}!(vMSZq1v$!8-&B4kT3(Jm6~n8n&^|xVus>V3~PRWtqIv}wqA6+ z3ufp%n=R2K{yMdNb{nP&|84EGL8tidGm7oMCW^6wm+$J>W>8sc!}Kf+w;>FOyh59! zZ9&@9NE^id>f6TA2D@PozpZaO zO}SN=Q)NdRQja7sYdvN(yFbZR&m{7AF~6a$kNmr%V`Jgf`RN4LL>+5RA2mU}BC|m> zy(x%(odPk`_(2Rik0nw?Ghn=%3NiRKw>2_}zfP@V3)?vT@BS1UHfda%mu4HN|2@&t zHckKAwYBY@{x`F&4O_0q?*-{by!q>?bfZ1!kGda}MEyFT@h83t)PW~nkD>J)0nGV2 zFo}XY0l54)rhb>swlUQE4TI%>ceZKN_oU6HJ=?_w9|#Z}qU&axs{j2v-3AlMrJK6j zHtBz}9>CS|9T9bJqf!-brj2Bx% z+O3D!Voj!}wVa{0xgvcx*S63^r-vJh$k`L^=vE%EcZ~q{u;D^Q@z<#>8zETdzcHh1 z*t_uGm-B5;=zqJ7wmpVG%0TGBfv*BPu9>}IiTwEQ=02K0&XKmdwUR38Rn?<`v}J)UG3h>Y1bCzK}%2mZ#+u?^P$zBku4 zT>h1&dB_uDRx;MEdA4-@@1OH+bM(JYmDrxvE2LCFYZ{l@=GV@@vB*HBwAFy;Jp~~! zK^ndo`LCZAs?QA|kJ0A8SDwWvNvyw?LIEFldqBu9(m_mc!*XGExK{W|+iWigcM`4= zoo5hGSL%PyKWE#b|9xt$?FIcWn0M=c-z86%P)*flykL+KT~M{a^+G|J?9&^B8t`Ao zCWB>d-DVry8!m0WMOZ@q+h(h6lKyx9HqYPW?Y7Q(>8u^L@Az*WZN@HJds#}yU$$Aa zw|Cnn=ve7{ZE!T0;s^UYQpu_^q#!DowGR(Kg(OywLpCg0Tmc|VY5x22tF|Hhw~kg% z6U0B6iIviFDw@nkY`rS*s<3qS<{Ys_nvlikC6A&B@sFT#AzI?=Vj!cBTZ`zguXmkEG zvFh>Po7ZiR>wl+zDMr)wZD0}Qe1%o-dRyJFX*a(TRgqUT+f7@Z{`ZM*Y$No)-+n8G zm=VT)FVuto*8CvUu-R!C`D?dqqbdCzgO_o)Z80X1SG2M_Vi@_a^{#EYQTmg&^cNwc z_%nD@W$k~(+&t)9TKR-w^(eA{Al}n>$Ej3PS>Sre?bCIZ-8EW z@fS?<-Ht{@`#n_rp%cdY`Fmm!#9ya&?!GXzOI`|VN0kMpCgpqWPt*A?^$$YRAd~$x zo#`YO+v{-H0DCFfhrr>s1Oia`HwL5TokSWFWbZ|f-9!1=Ap2p{ zXziI``|p8t<3AA2k5>C!y8445oFz7UCzHtI;u^bsoBnsH)4o{$TVJ(z)&EYfV=vPG z{uFM5(eKA&>=;t~b!wG$?XY$H zw@E!a_JI$#7rn7sJ5gM`y_lMGz%p_u-rm$C{vslqV23XL>2C=0YJK|z`ZfSWCpECc zq~otsTbg9YS(Cqp*{7{Z{UC|5lhN?yJdD(_WQb+jMtmfTcZGMF*e6rzOS+>&^P2)X zVF31J2bw`B*#l9dZ*!E@{MV>a+QL4Mrv72nh))4@e;k+*^wyM}Q`cNS6F^f!>X>O( zs(lcxj0cTdslb}CTc@$+m$MxyuO(O-ya(Hs(=F|5;iTPxC3&}veI`}jHTtPtHjO?W0D1qXBUqg|5UhUvC%W+NM{VfRAh3G)FO)wz809x!Kq+##87)TllY5oJl_NTOT?B6-MFB9g|gwIXTZ+A5M@*TSPB4RIY4iNjSSl76m2 zk@Rwvip1h77s)bLu}ETFQ$|7EY77VKR9^CNm|>C3E9N66AVTBqrBVk@&mT z$lOMe1iQ*)?s1tc_Fsrnn`^(!J}nY|*DjF+x}Fq?pX-oFLS0)#(#-XgNc>&-A_;Ik zCXztcJeivy5+%h{|CI@6PS|%e!66|_L zB>t|6BJp#v)cjnlB+6`=ye5<9WU@>qi)8YmOqR%Gfk^yZ`;fE+r?1G;NixY3iN!Ts z=3bV`N|E@vNaj}1umbx-rh~Mx0P}S$C6Bf@Gd)j(M%&x^&Ge^JfwojXe8{$5S6f}1 z5Z}nPuBz6ie~otK)7PWzz3U5kp)9pr;?o*Y!P%vJ5lirl|_a&P+NPW$BE@yWgCll#CYSD9d9 z`HC4`=6cbaTZrs7Zx*@jKDnJfx!pdwy*{}Yl4KKN@|U^R`{XwI^T{2rom=QSSv%`G<&%5EC-;_5?n0_;a4|Rd zkx%XupWLTDIWbv;s*AZ(=32PAv&;&kQ|4OZlPmYhkx%XgpWJ$%+(w_=W}n;^pWN1k zKG~Oiayxu-yL@tDdW&9&*6%6;C=IF|DSvJy1UNMSNY2?~R!I zq+?C2X&sH~hT^JSxE2N9eGk;qH#_>`s+?|kC*p;D4ts#9N)o(!2wy+8M&bnEM+Y5O zY^FWh!D`3tVABY#@*RhNuxUA?X(!J)-i!(sP7TNQBpfM0ia| zgx7>bcuh!z*MvlPO-O{-ghZG#B*JMzBAg~9!f8SxoF*jts=r0%gwupVVZV?(CY&y$ zx)&h4Cgh|Wz+Mw_!fQezye1^VE+7$J6B2k$A`wm#65%u<5l#~lF-?#NrwNI0nve*m z35nioI86&hR(MTFgx7>bcuh!z*Mww|OoZ2jobZ~E2(Jl=@S2barwNI0nve*m3CVDo z2&V}-;WQx;P7{(9oXncF9B$O-!AcKyYuxPkyV>n`v)Autr{B#!zuUDMmE7#{yV>D) zv%l|Vci+w4zMGwWH~ac-cJATs{ce9`Gc8MwAW+&gxKEB&kD8%7r7vIeuzMCC< zH~aT)cJJNn-Md*$-K?c1OqGvrF%0<#e-dx>+^dE}@xj zC?=G^&5G$}y>z?8vg~H1bhA#nStZ@9k#1H72T|fZdOD$ z>!F){cQ?E4ZdO9KaNHN7F`Wo}2Z~ z&1&ant#h-|xmoAjta5I4)7`9ZZdNxpYg>OeYnz*u&FvDp=4MrMv!=OO(cG+OZdNll zYnhvs%FG>`>ZC2uBNoT#}wL*KO&2@0N>0imLo~~|v=-Tf<4V`MQ6Jh{pq($i?D?Z$Z zoMY5Tdds5N(Z(khB@IcCRq22v9f?HCVKUK_In8dR1A(T%(6t_7hpb9BAR`_jdeF_L zJS6Lk=tGO1!L=Q>|Ki?evf`@IxMF)S9k(e8@Xp(mhb7(^9WT|c!~u|HS2{_+BptBT zt~8V-Q}mKmM{pU|D4T*i8&s3k+b^qwCH06y$&eKu>qA@SSWI6JC)wDR%su)Fc?CKOfkjP>S&mv3<3IRMd>B++J1KfJ`wxYBJ z;2z)-u&NK;NCSb>jZN|Rjv#kvlPnc zY^qD68Y#g5ri3f~k(7ojLnO{_8eI=KE7DD7Dw}7=cYPz2UkxCAdBAHZ2DtXA&jWT-i?>wA57wAsJm)86YcN??VeuLfrN0fulQhl>|T?u}UVA5wS`? zB)emk!6vPuo-$mN)#GmOtEUV=SsZ8j$MHZ^#&NA5)u9xDmN2MlACglY{owS3nZ5)zfcQfLu$BMGPlEA4i#URNh7gJe6gnKXJcq}-=D+5u7kWj!5^SLf?1IO!;w zim!!GQEm#Sef1T1X983|lS~SDytv2|L8)YFM79P7tYId_HvuekwLRU(fFz@1WoYn9 zBpR$*Z%Uvuo=VL!DRm`ak3MJbN~uW(t&~hTElTR5O1(-`l(!>GlUSE8Cn>#UciYp! zCg^VQc9ZJUY^O{*6$9M^Ac*!gR3c>;y4Dsm!>V?hEIu_eGUIkDCZ`V{*_pKPAcS+W zv4Yovg!~8mgZV&;Pgd$k*x*cQF)*p{8e&pC)$TKWbG=nlp)Ti>m0nVQqv%2_$nWGj zyTga!(R4XQmWNVh6P`AEn;1$x(Mv6oQkp8bw^{J#lC(B&usdpL%~WtU0h&?OROyVS ze`u;?N|tA$gZiw4I(-1i6g5*CNK&&Usf{0+9Nxjd+KlH|i{?r;2rX#NR`AjR zEqI>hw@?O13d^KevuiAlw$C5^rSNYZR zl3&=0W%fZUr4M=(*_u0+-`ZG@-mW$GDcIG( zb3&m%>-yQeU30a=K3}7K?UaX*+-+wV)*rk>javkp`UOz8q}uh$+A9O4jPJ6Hn@FTh zlft3e9Sp1Z%Ri{#J1CG08Y=0abVpL%fqj?<9gKPPFB;uh38!uAjIpuTkWE>yB^N7P7r)s7dxJ90B|os0$EBI}HL7KGiMlo&L= ztrO3z>z$OY$i;Q$WCRkaBz0wtS2`wSDYjXEFA&h z(k@D*tkPJPCiFpRaXw^Oo#j_+g5K)F+MC|hn1pE(e{WZ%4Vu2umFI6-H>JNM*O3x4 zlr~h5j(f(>AGKS3EKnCwR|l^84mT>sr7Iz_Ub-aPJzePpvh&l$I!x!%S+`>|n1^W@ zTzD#jZH2QtFP0;_vvO?duJn+E@+6`A-IcboV5BT4>#c-W%*HJwt{w`GVhiI|AR$5^ zfYj>r$sWq15@mviS`>ABNU0}FC(F|GM=-7rPTFIAI$21gv!LepPujyMzuF#3w;nR) zMUkv$e^_ZH3C-}3kEDCm_DCN>vm}s5Ci_%vU;WC%27mKBoOF~FOJwUSmiqawR*NKJ zbry!1mivW!XPLdHp*_#ax|?w$iWj`8r=g}RBsl6(B}TSYR*UAbirO?6K59&w3WB3~9U|L8-kAX>5=Ue6y)``+IvSU1W1FN_oGd*qOEE#h>G5~$cpoFvXt7#?SQu$Xpo{l2l?Yku4GF@`O#w5b`WjaFU0IGs z@ok>twUxA{ukw(rd(KlgoYLR3E8f9d(9al$PeiAhQQx=x6gtt54Ui*Cy2DvUTUR9= z$f~6zd_xvM;>~2iSDu0hDn3`+=9Xj|EqyO>xRdig@{91%>01KWl*&Hw!}mdQ47t?E zDvt_5R-UoreP$2nX9?m-@Y?5ob$qD(S_}B_+1fKCtG|*dS^it%9P19+=dbzIT9~i& zXG79r058lX1K8X6V1SY(E1Kzo;0H{>(HWowQ;YBYoLkT$WsDZ?}-VZnxgL$PmIM}d!O(f7Z zL}@A+Yc30zv8o|TV0nSRnd%MW!7m-cruEDaqxrTHnU%TnV|ye%eP|3%2MK~n#RnQf z{G+ML1L`b6%rrp3v^mT_$Y+eY(T!XvUUe>Z{I9T}lnhL+etEo{Y?jI0 zJY!|cm-Sh=j?eA2Y~ae_T>r{&!%|MF#Yd+m{#F__!VuOJ34+i?)MnoZW9X*Ws*;iF z@4GNQ=BX4x87=+oJ`$WGfg45|v+xNIb~ybuQi()6_EClwlu95^n1su<=fuWQ+>0Ma z8Pat7q6U#GUkL}X(tNgv2lF{B@m0Q(F1@MpesrJ;{$k%TiV`_~Y^(gKMdQZ%>`9)l zg+W!l{X>16@b&#@dNgKJqg;Q5j%E5sQpRY*!QF(Kv4Gh}8}X$r{p7Zmv0cuH7;CK< z*0z3fZ^Xd30sc`;3cPr74oYvD~i?W4Un5SRSZV zW4X`OW7!M-X)Fh362`GL&K}3^*NSoM5Pl#N^LVAR6w9aRmKm&9%=35B!mkkzSTNqu zhA-&CIHeIC7;i*Mu0Tsg9Elb{20xEi>VTn;2}*Z4WB()3%WfhlHh+QN7V z(CS&pG0>tyw%ErDjV)jb+G;NJYbuXy&Q!J@8)WYER37}hQN7$l&ZWLrr^T$tf`FXM0_;6&c07vnXc^Xnp!K{QGPa%i-)x zi;59be5{D)=<*_^HQJ~yQpA3}rbuarq;W9^uI3lBJAJU2)%I?&GC?vqE=z_}hW=*n z>XppV>B?iMn>s_8BpaGaC#Nf2DPe4+LdDG@qiDfQjwo4YDsv^qObmNFB#Z_ZMtOWbF&}XhiCm`I% z3=+LN3w_LXMK+<^bB$fxI}*g#BprC%*mhPzS3W>f7aupm zj9athZWxU>r^3?_YOOHuiYJu0lEqzmJz({rsq+j4*qc>xUNYW_&Idapd_y%=SyXmT ziL97!L?;hr(Ulb77td#}LY{!#7b>~HTDMRcDoK3=7Lw4Sz0}bEi&<2fhtWP(swC3J7bC+x zreag6GECOGoFxN2qZR_^K^wexTUHrq@gVkJq>Mx>Rf~-9@Yk3g!iqD)X-#qe;e5s6 zAP1>pV?E+YHd*_gWWVd)lWcgKKE;N2_*1O;>z^{3{*!G@U5f4(kl@wBZcnpCp8B-X zR&wZ{P1iLgfr=v?=I}A2$4(hPZJf`N6hx)Zz#&K#yY?>2Fx3Sng$)U)6-!NfhJz>b zo-wunc3ElDEmXSwtWoKAJi0(Ptcy85kiD26EIhlIqxPp38{T-FtQ-HVk|d{IqAbAn zUId{RKFi+6g=Y=luqiEi9u88kB^;S5TB3{q)(1mYo*Rs|3Pi`7(RUTmu^!EBvQilhDJ)yb8hLr85o#|KgONs?*9YJm?i)b7 zbd?dIC=$JCP3KoeJ8F9(GqOc&88O{GqVJ6zwIbWi%Xk5sSEl4iO_)bFR)R$FOVN=Y zPMWV~eJELNIO0z;QpNs&aJsyOr+mV5hKssX@X)bhjS}K3`xV(TJb3Ln<3URqV^WLe zj!+-jt`XGJ==$k^aLbs&nVzXaC)X&$B$wEiKd*Em$MFDrEfZM0Rv89~y|-2wk0h;J z87uYkrEJQX4KuQM4Fc?rozeK{O1WWxcY1XfAKd(RKnxY7Il_Ed-;*uP(2BLFU%E3o z)FYYw6-qvuvXL@YGWLp4nobnk+F_%UWSCwpTP_-3?8E@%ydQvz-;1Inspth`;EsB_ z9ELmfq8*gKjn}{V&l_f|nsq8g)-LN36;P|+@h>R3vZtrLoYtpX4@W7!9eGzLl5iuS zRwyZM9e1K+o$;jZLn1IN3GrMj~m#r=)RG4uxz8;No`afmDFpzGa6steGm{zC0!jMUPC*5 zlVP8*$rjTmr<)_HVzV*R{*ZI(d}v@G+4n_9);2WQaf=EJE8EPQ)IFQoRr_Nz&${82 zhR+(3BUh!VV)FFq?uekO4V(65uc9nTsjF6m@rtel#si;n% zgRX2bXw=E6H97Y`*6xvV~9nR_}i<{@j<+aNTAQ*Qb z8W%&9MLRr=p4`UP$?=l$q_1u5zT0}^mecB4Q9-o-CBv)fptl299eVJRFx_NmPj%np~9;@5i4Hy1VeIWW}I>M=Bhe5Otl^nz{m-fa@oF_6JAwFgX zTcX`cTE$K!LiRKV1F;$c$k_#V@nl9|tw74uoxBnq->Hm3>#@6(k#e?=pael;Hv-AU zy#s40{`mcE`9rarp8C5H|QB`(bat(2^KX1aR7P`qumU={NNE!5(m(bkR}x#Qh^6n<3o z0pUO#R6@b;;|F;Udg7q+h#c_)bn1}OoK6mRB(jqu`gDjr%-0VYZsCy}k2|E&*`+Oi;3Heei`Yg6#_l}GOLO06_)MjR}8IwhqbyXoym7Z`*ibtoCEEty)&8t^ z#;Uabg+R%u6x@Xzxi>udDi6n(uPTp7z^9mC;?xU2Im&qkVsKOj`ZoH7jtuTz zQCdmv{?bcufToEoxsQ?+Y7AXE2v##D!d+uXa zb4nQ@D~{?fjm7#?2=N@RkC*wS&(2gwLrmfbNyWdFREa*WznrgonmB#L+ctkVn^;=u|+(DTM29;6&LB3VBn>mb7Q;gYxriM>|8>Gw{>~PgA+# z<2pRlkdUOGs>actqt1zAn& z&tQREO@E$I@`D-ull~%_(uA%*jZIPMIocex<8%P(e@{r7d-M)@d9HKMx0WH8r`wH5Xq{CL(wHf-*_g z{JB4!cp0L&`UOt))vR(PP`}GD_}=+tJmy{X5f&F_>(~CYVk)q%eTZqWno>SeCQ88H zUVd9q<;O9BG;Mwm&eVJe=Xfc)frHW&9pU+#&qIFT^r?mh%Lctx_(h9MAGk5Wh#`wXB`2Lz4*b$V8i)s%mQRdDYWn7DQH!xbefc%4wep#x~kQwYcYa9->; zu3;jkj*1P{*=LNr0rFJXrLVA(<2`@?x>M;$rkbl*1sGxE0I@>X7q#02aY+HSyaY;2 zuJW2v7cIVi4a?Iy`tur$>N?82j%Wv?77mbRbo+&%R5-A)s%}Qtk@W`De;pOxK+Ka- zXGyB1mxDYVUq@ZO#Co@m7JUh~VI5uj65&clUNpd?cX+ActDsi2>g%9Tk3iPZ@&72Z zB}t|>xiVOU&Ab{L+D?bfaK=anB?my z?k1LhuCQSMjrs*LExn0lWgQ*737OBOnwu~pbA`;e51@08!ffV$gO=vf{%B4}}RzHP9_j5GA6 z7n+J{XK%qfVZe_%0MRV1MRJ%es}OJql%W?Q63Rg?qHp* zqPQAF(yM4-4HTh@p082zB!#enQg0o1jmE44>D2d1Je?mD9B53PDstb&@Kn(|ca>g9 zoIi>7sK-wj(<*x6Cq(|L==Gnlv{lh}Kf&5pQT)$XSE^{l&v?GFhgSUzFKiE;{}~?I z9;*8bV0$R{7d$K8BZjR5wfr4%ypz9RZg4?oS%3r4tz|(sPeB}Qo)_$SXtIaO{tM~v zp&S3jR(=n)_|>4}r@~=vBS&$>u=5-DwE6ECu{|{EclcafW6VGin2n%U zepiwJ_#6P!2vYxmSVz!^KVbL8+s&?`fgCu$xhFW8D*u4dX|W~P^H^yFwfYm2VFa!F z6N?_>&mAb8yU4$oUjM(~H!z@tHvg$)(6vSJb#!yZ#ft_?``PZSBf>M?M^MJ!(4Y~t z;%_{X89}H1M(}wAneHLx!L`aLBM7&@7T?1ja5*iw2k>$_eh(+4my`28v|qfE?bDmRl>_At5yh?Pz{?1IFQuu?FIy#wV#&eI=a z4WIh4BcwcE4VIv)fpQ*Jd>Gu&P|xM%2i5)({OUmYFg3xXc9bQr4U~bfIVQEcEIBq% zx{u}{6*tme#E9m65gb7GOlpWkIN>D{PuZV(y)9<$l$bKG1lKL7UVJtfK~+E12L3nu zsk#W>9w;87)u(BnVNaOg&wWkySGxnr<*yD#Qthv1A+ZOjZDgAl(Pd$|Mh2*jg1DW} zX>*|3kXGFdu21I!jQ(HtGH(+wT#NY=uBD9)R6}I7YhsWZQBI&5Dk*>IrHmU*eh>CI zFUx6Npen}hcA(l9N#`K74U*y@RgCL_Aa$T5@JsC`Q-jq+K>G))ZDo6ZQVV}Io~o}Q z3{o9zaB+`{{2_pvU^NBU@gdyXX(4J`Nit{j;P_->`r$UWU3?C%i>O`vk5|NhFFtxE{CyL5Kp`$qkao#sCmeYzb7XG;~ zb&zBraS+`e0SDl4vk>nSt>rY*tUf9c8V{07{`M9j?I=5pS$SYqTT5t*LGlq)UyGUq zuBKZI{cAnQqZ};&uvyhqB;BlPJ0!ELYF8vLTh-R4BlL|`?ZPkmxq9ktW!L~eLM1je zGf2Dv=;}+|L)9qy#-_HEnAwBm8S{2_wW~zIQsYqD&_27GBvA$rk`v^PU2P6xu?}@4 zk|!MC;0PUbs68awXo&g)7$S#LeMpv!8ziHSH*Y!WQ{IdO3vG6)K@v7`kaYSP)?#{s zU3Wl^&|glq0E9;<>R2SzirNav&oXJGst+OOQq>emX8s^L^&+0!9a7a80M4jtCkc3R zka+nfk~;29aM1a^Apz9okQ!ntpdNM9UPzYJQHKW=2$3uo{f(mEe|B`FuHiUe%B8C+ z6cip$Qn_{%op>oBoHmDpeFi@_NIqfxAlX1T@MMVRBuoK0BGgf6r6@ujDl4oXBwf{d zF={fM{|(DRwi`E>RmMRN3aDwMIu6OINOg!r-&UJ`S&SM@Y1<*cg}V}rlLiHp6Qw>T zncYpPk!l7N|BV+ySFH)Ld(Qqaulwj=ETB2N6QVqpxq!-|)gn_tMT|N|(l{)!n8tw^ zHA?bvWKhLfNb%1^(arnVY@FB};yF4{KuzkZBV_fHw7I_M*?mVV!-y8pt-9)HbSpbn z9f4$TtU6v&eSeVLqNdhU+sTr%-r@2bnJl2ndTK98{$nbuqc*0Rw?d+*_)3D4uGcY! z;#03=@wTWySa3PP2$Zt`z7XPp>nvcm;?#KXVvRQ>eSHvBPe&K0Mxl#9iKgB0YKm<2 zKc0#Sv~*i7(RWKQy7C=#9FLr7U$m^AKxNe-AoNWLR)S>MSmxlzfAE+>MTv%{-4TLk z?h?pxIYH4ULIK`;QS-rS*ZM5Ib@kN=$e9{&Zd3z<0TaIUD7O2MrQZGQ>j@$H(#(wq z43IBKMI#_OO;~J~YX`0>XdEQn)EgGqL z5-EBx6_=p#h@V4RP>zzAOedn$Ai-v1b&^DhN9z}Xf|=5Wihm68EEWayabtC+L~1yg zD(j2!wd1PswC`}CM3FPmPQ{5#tSVWZ44TnRU=a#vK@-@A0=n8nb;-(Y221w~!n z=teWOr=;0)usqPR!xHN0ObLx@js>BFDx0gBNPcXt_6;r(=4Bw{DBc zgwLptOXKgGpk!QqlFnB}!`gi9PG!D+OjR=_+H{?vMomH!X+hJ_P+FLV<&sG}rnAPd z>;$Lh^c+Lyh-Qc`7I$hxQi{--je!L zpf1j(ZA`(PYL%TrRoa-BXr{DQYLM*LVtgkI4HUG(+RFspbhkMQ823PHHGr}kI0NZS zE2GQH4N*35rm(bRL#qbU-KJ>hVn%3V!}Df(&-v1GfW1?#v5u9{@2#=2lu(y8Eb66g z)c(j_ZlexD(z30ZBMI*qEMr)k+p3)bxC8)_=IzupBqQ6Y9gtMCQ`05)hlMzzD0xMq z=c&qCGPehKtXhZeV29l;E$);sWNQ)go%Fvoy5Bm)&4(EeKL z(gFOfrPUqOY$P{2sDmZtb3(DDgusq{(zk`ABeQVst zklK;?*xMB=E93pGYt`P460Z(rbW@!Y_Q2c4wz9-;i0s(xve0;pp5?S6fR_IB9e?1{z&yB~j`Okxx%HXRuVRWf-($ zhDd7-+RlnDPNiZGrg^`v@J!ay^6u&|Sv_Hh3^o~9)NEg<=X3`1&|rvkt@3-QZ6ptk zXmmgD@TZVMMrCLe6&?(Q1zmuM#ajBIhgv8}H}`VZfHpO(k2e|94T+}?kx|wUA5s-m z`uZWvjI|W|u-aAD?Jz`!{^mT4HFPV{!`OIi#S?nf6|_|-bPuZO0ktcAM144z3mzFF zed4z=oSrwJx6=Jb)Mlom)U+o&*`t)#6ZYvSZIH>;p4ep_6~uDU!)!WAwH37;WkWf9x3D z>!ps6_|t|+zjsb=^o}V^A403QK!TzB>U-9@WAt-x%&lYeP#-M2$EdQ8+6~FIJ}?i* zsAZm*eUOy&RlDGG8OQpnk0SB!r{*FV(GOFwNN~Mj z2pt@Sz0TG433j^P7dGIpeyT;nHtVW#v3&xzhJEoVjJ{c_T~yCfTOwJR1<$yMPGwRWJT0nTu%oU?%kbU<@Dx zI>aFKt0eSk7HXvCIqMlK3b*oy1R|~!L@RT_;pRNtGEg%F-W|jL_N}bYg6uF)G>9=C zNQ_m>a0y7tB>Zd|7?x`};2xzEqcRU63?^H6!# z7yPt9PhQW(ez%Cs!>|eD7VFTh5o!Wm8`HpZj-`mohQU-7(fMIUOZA58rmA}bJluBS zrftXgFgz~EQ_aA8B2OJAsWqTe;Dr`;ZxANXEaVujDiYL)9K(D-`NLU*i-uzrU{;#z z-MKnkZ2+o%BUtu5M_~8M@V4lj@SYaW3ad|>9}f$q>my+Qi|E@CSZs?ZaU^p+dL&i@ zuF!p`j9Znl4puz6bm4K6kM|++A|7^W>G~xPt30Qus%h!FdwtEh~CTRDRnR3 z(7h2urK#`QUk#~nVG7orj5#V!)5{L#iw-7G%KET6bh1EIBoAYT%EzF03b4CpuEr0Q zoA`{;JR;LZ8}o9C7d47-rF~s+VIG5hb`fA)y3pI_vJ+x~B? z6NR*596WmlF2%rzch7f^L+FPulP{TyPz=LX(B>IxQ_IA$9t|y|lJS_q3|%vn`d`QL zczz;GjraEW<5RH66;k{JYz!Fhg`u8#t>eX8lFXEK4Nr&)>Cy!F8H~4?TjNXOjY(ff zMH7wYUh+1Vj(Uzs>Ht}94_%+2B3>viijNUjy_ZhKZlaK0pM;Swq(3I9y(A;A43&Y4 zQIoO4bCa4^i8>0@$yhZQaD1qErW7x(V~_MQv(ANuu#jq8>O_fldMF2558n*yLf4;g zTIs|TC~YB~o}x}i(xFf-MRKGN`bBuW?LMn*h*h8g^!d zR54ARD&aSVlIbzP(`Uff&blAgkjEv@L~i^nfvdD%0SMX zK(i;(Sx6^~u}Lqa#OdlxB<0i9Z!>uSteb(wu8=;NVF><#SMUnod|vh}zS$&t zD(m~@ddHXHxEbA|?@O7Tz+9??9yup@4ia;5NG@HP0i{cO3_%DkG3VCODBOzPs8%bs zTCI@h#&oKA%wWTrD^H6oNix@^v{^=Rom{$m1<_HgDvG=yy<`?E=(Drb@#yERSy=E3 zsn2Y643d4bu}l@xce8merp-YFtdLgDffZv0o9FTlyJD^yhw}Kj*eP;(t6Vxh277zH zZ2amfAMv!!l}mqinKRi~F1b>NT+ht&UQ@11qH`|0rfYD+u4i>Fq&<(rhvB;2A&p6x zdpA$wigWvOPS4rvLP~i8o zRXnA7zbe5fluN62;$h_GC$VSXl686|JhKX-h?V9PY_<~bSHQE` zu>~5v;wfltIiZ09NoISl+!<`&f-Aaz6qjnBb7N`XCU!wSB36{Y0dB_Br{RB>)5fRO z0Z3||hKE;9-JfB}mOTU2<|?n{$_2RJT2#T^;1LwR7~{*ZW4UrwTUBnriWaL5P$^xE zokKZki?M=1E{ow;l~c;IY7ZpSk;v+2Kw9{uU%z6GtiUa9-mczzmIpm;38MSl(#2dV zd0*)DPG`7t^f-^fVBqH!OVt*153>#e=KE?a6K-qi;%c%y2i`%Bei zS^pQkm|et2m#Hme@oz9d$6>%<+v`m6QhR?HYzH@cPoK&u%hhB#?Ej+D6>6uj-o|FA zoGO>YM`diheF2y~%L5bBAyih#@f6a$6-EV|xEI8xdSTX;1}t2{W_w|qSHjyWr_WYm z4Japdl_A%}VIm$9MVp?3Y;q1cTlk1HX_)lo&#i(##cVeI2fiw|!=(MKSOcrdC0WDdcKnNSjF)i*v~hg6 zoYL09vZDR9M*BmD$(8TdwcMNL1cuJgq1!v+LSVjJ z8MiW9$@VGd$RdG?XXVogF z;V-}wkT1q80N8!x|!WfMWnVQzN8sfC>yVmz*cU+Hn^O+ZZz!uPF*jb z?bO&4F=fv8Q1y#yU7G)n(_E|Pw>EOyT{q$3Tsh6#gitYKYq}hM+@v-Jpw4DBO#+S& zqvMOAdmG>L?pMoc!DhqqyfI8Z32(6uYk2AV&SqYNl2~ad-@C(Pbmxz}#%5YoX$<}c z!zit%T8G}A1D!Zg$*alRm14SAY*BlIjXqn{3?$38-~l1Cd5Oxlz_HFc>%_g-8hmFlZXNbK z7b>SyTh$CHnP0uFHk2iQcuOJ)*9&_B`sH|pgTPZc9Y(^RA$9rZ$)|^ZZBt`pNl+e@ z{)B}lY&$mlj*k#;%y|ht6dx^hh2oPZ;*jXXkFa6dh~gkFwou|;OwNlRIU5+gEv8#9 zVX-U5Lp!(%jD?5NJE7u#y=d{AG%2P7+to)TxGtIYsP*X5OBS3)2}#CrU|cIKn~eiY z;$+#l9cna4mh8ZewV0}RKnIJ-x)V!mF+H*q?olzhcS5&|>9d^}zG8CjGN`u`)RV+* zzKtc#j(PIwXfh>-8xx7y>;j4OMc4n@g(s|BlAb3&F?d} z8j7jk9;}(gG)e4$HwgTp=8gQnW^-DrG0mN zlvURM4x|?{lWCcfObwHPkPxb%G(}gM20MfnAwq^UQtS{A6~UqH0!I`n3W!LzJkkVw zac!Wm>Mly(RbSnew(71T=(nR!U~ecnHQ@9&>EXTIm$bI-j`yZ1i#IVZ9a&Q{Zl z8!@p{g{w!(_rp1-@V3Xh2}f4JbtC!QwQ~|){af5>s@jATvzk_JQbs=Cgt31$c{iH} zNE@5^xaZN-)23`rn;ZXHvzpd##+pPm{bMu6SJmX)g11Q3bn6z?_Jv#Utg5E70tU9? zIaf_%wkp}mt$5s3(^p&3nbl<6hH`7^#%-u}Ek(EC1@T(Cunkj8j*%PLh{M94@DBRM z)LS;ctfeXZ>so@RGmKE|&44LqTd6*#Yjf_3!-@s#D>3lenO7>$47taox37exe zJdc$0@JO|Qk^BZUII}FW!e%cv;&fNiPe;nq`Tcezo~=7?N~3YT!||PwO5?91>B3&T zEHqw|>E~@cF#h427{sonyzMw0*HZ0vObC?f-($|6+>RbzOTHa(!M8C%o3o}umGqUS zcfzd?fyH*dV4iHizHV5hQud?%jSO8!%)AvK57uNq_T z*pwkeE8B~=`O`1qB^;8kCdU?b*3v_J;+{FmV(=TjU-1*KcbPn1zuRHXqAmZ08(4O6!Q9PnUkr9MN!hB_&kAMEOSw$I@SF= z{0`RUl*VmkvhybIPuTFHkUPs{7CrV)<^nkK)St}P_EABO3I-c~H>vNWzOx$_%~%xK zj!>_We@xNiy%x8U9%&(6@~)Xff946fPRK|h4}z2_>#q)LX}xA#YwNpONvB>VeXo^t zT?;9lmwMX0r+g?BGFZqY5UG63EiEg5tGspPZ?%#d?rkl-&`O%nLQ1Eko?nHy--i$D zske}OK+4pYB;AL%th`NyZvG9v)%9v6O}rvip9b`4B^}j5iZ2aNT|J!@lJNolt)UJ~ z7ShciWoqYk`fV*M?|YwKxsn#Qk`BL0+P9T-LJKMF<$9i_6GAQtaek=4Ye34>p5>*j z419FOfZDPAVk_xaS4m%QCH>}#bTe(?dazYj$ag~04k)kyq--;Htnv1iEx&i7-f|^% zw31d|CH1$GK6pj?3a#XNUZJ;`jG|*gE(*yxh{~f}`Jz?^uAih=uB0Edk`BL0`j=MH zaV?~@02N?I+$JFhg#1HD%180aU3au>`L-4Y*tK9Q>F%qfomxo`w2;ztRDfM*%Z2O` z@`aF}K+4p%lP6mlm{+N{TuBeNl74oTH2Kb!j(a0l$|6n}DxXI4glrJe)#(LZVD+X}ys5K+4oRn3TI)R(^k#?!A)QTS*sR zB`t0xUEM-T{r{}08zbaVAy<0%3$3KRu99wTB^}yAN}WGZ z_1q$)O2`}`>p-M(%RMby{y_@^e6|N#Nk6|zTHH$dT?;9BKSkx!sjrYxLLL_K3`m)p zElzA@pi7P3awUDJm9*k2>B?5p1udjx{0x<2QBlZHArT=@fk@@AjA+^NFKSy?zPpw5 z%vI6@t)#}fD`l7bMb(|hq>io=GE&HcAZ2Re)L~@Hx@)eKSJJMnqz_#sy{?t?@fK1# zFZHzhD=M$1LLq~NOaduWGn%Jb8Tk5&0VQ43O8Vnf(v_{GKV6YxSj+XSrC)`(kMKXO z_YsVYk=E+z&#}`-qaB}PQlrt2pJU6zdg}89-mI>tr@p{i!W;DGFR=1aPyVAQQBMs= zF=}5!e>#de(LxFw!$!n~H1n9bLVb7?#h#<%SUgERj=_NC*FJZbyL=Sg!aK zD0Ti){@#LTUHu7Ew3&9F!1((W$~uWbJ3f;*iDCFCdh?`tr260>>Y?2yG1u&TO6{Aj zIR!tWwC5BCoZHEA8fCWA_|qsej&`5Mn0OrJ{0(p4rcvYH;OaDb_iq>>FQUA^que5@ z{W~_5yhtDY9j{bgq>?XDUamlGzEb;6=6)4>TOM`N!mlyE{_QLE zrn$@4sH=*iUz^9M7k5z~i=CAA-{xUS{CXwYNq`6b+dN!=4g!4h-)c2|#*gTWe&1lK zxR@HhQA+~*zQK&Kj#9qG+wN+*<6AXteePQ|rau2Iyjn|x{(-(4PmBJ6e`D~05;}M? z75@|OxF*o#f1(#A(2jq?{sg-GPfS-P&~@Lbf6d=Pa{}%A4yz3lDDezhx{hu+gQ5Pt z^hY5_&fw@jN9MCod5-Qri}pQ7ThF2spQFrksBZ(^cMg47N!!n1np{agpF<6mbj^9p zgqo=7Jp62;56+|gP27G5eS9A8I=WmicWDJQU%<)s5^cJGb%>YfhYRrGCF=DrwCg2$ z{9ovZN9pjtaI!s0zVFc>MO^gs_t+4yf_8t8zF9%3KR|s2-SGn)Sx$?7z?rk0zWxC( zm6j7a7B5$S#8FcG??K-G5uH#&8UKchHB|m@Sg)b2|Auu%T;%!>j>8Bl{SOR{pcnpw zlVk*a{~zcrWpxYP{S&%)DVMR(OFyBbV*I~MHm_`0en1aork(ba5 zbLgc@@aB*7^Cfe60_UZn&X>($nsphA8qd?-%edwikoQ-dBoEQVU*Xb|^aB6eM&JI5 zPFh9Xe}kD-^w@7$l~_d^e?yO~qEo*?bJb#(<)$P~Rugs6iuvu_i)UJH0Q#=wPN?J> zEZsqFH(2_D{J~%;0@-J@Z(gw0ddbo{c0LZR3mSG8vs@ZKU zb_%w&bTK?acek}%W4MnNw1w?u^mSXyt%irGM}nm{$dm+2C&Ox5kzna&SV^BISOz9= zmK(a9U~y89L`zS@XsSuH+-7(JIrc2$4HGFp31*t*YMt@GXj4-@Pg&CGn37ppk-*s4Q^g;%@hUiEJDx6EMOv_A_)h5!b z!SK5$7e%fEkqjbz1n92=0|XezfSNhoD8S7+Fi3!*45-=DFab&#P!p!%0^FekcQznd z7wWx-ku~r#GD1{FF`#BaqXihJ1LXotU_eb|Dg>CM1C;_)F`ylScuEIm3lL>M%`N5%us{bEHXvCV zI$#ka>NADftLl?zltBC@nFffLJ=2Ss47@5pS zrT|6;IK^1RB!EQ+tODfdfI|Sc4&(~p)d8OXK^@2!prBbt!h#esz&Xt#odoF20B1Lg zlnBsG2f7Pz4Fk`yMlS)b(}6w$^w)s_0t}1;&5;`gxtWm-Y-ErCLmA-AX^~+9lw&v zfL#J0t5{^WAbS~E%4PNmuwMt>5#T)?cwc}63~(N@$Uy-P>A+zDKGlKG1USL~4{jo# zGtj&!a*Pp9suwvfDyMYdv;be~z*ho%qXXXx@SP5v5#T%noT4vsL4Y3^n8U!20{o-^ z&gvHVS&&PN{E>mn0{pHC01ura25@{M(Sbw(QW#jk8mR(gFz^rqnF1IYc#;8=02T(e zF<=GP468Ye@MtRH5EZu$`xqz}U;+cn7^o0n5(5u2P$@u_4pa+J2hyyv)G`G%E&_kJjwv4ON>kvU^)YwI59FqfX5l&6pE221bB)8b)L-@Aj-ge)|lHwbL^J1 zyEwOEWT8kGv6QncMivY33=s`$r(uk2 z6nqQg8yVOtz-tV=#=z?WyvYD3X^d5@;8Q3krULDvczV-gS^c!2P51BAyIApbAPOC|j$KUYzZpNt^yTF2;Uh&_m@^q-sL z@BbousWQXYF0Ant3$jEAU#|Ga7b(d9n7p(Z!vBx#rEHroFc7}1K=@(;;Y$dFFC38n zIeBTf|4sH%TJN&-H#BJfbXk@l7P$79-*RJz96p7kSvOQw7EP>Z96P?Yy1JaBDQk3c zsKte~vtNc}()Zbq@zCu0=(WqpYMe+(^#b{bab^xa9hgk;rhN@B-H;Boi z@#R%ja>Yc`<5+!DO$>^w-2kmSVpvK{jsI)E)mX+$DxPQ_8C(WWvby@BUjE}GuL(h; zG};=qaPr7QQH!gM))rqV{o~EuiWB4BN^E zDU70pG$03YNWG6(C65g30*KWS5FyeuO2Q-bkLhmo&vGr0l)%o>-fDw`^ED>YnFgzg zduc%>5Khn7LV@!va#}{olo<`sjM0W*TfMvzPrlcYrkXf*x;4y(`ZvN*yIDCVG32es z-{SiW##od4H(E>3s=CLJKyBj_S*gmLs(jC6L)w+DgTn|qI>Ty_&OkBj9+{Qp-~)xK zocssr>~gb{xKdTi{MGG~seh9pRo4NMnH)PBbZT9DJ1u|EAnw9}px*A%Ia%q-5#>B* zb&Pp?>Jh7Cz=`H9dEDS(!~JGj;|Hk8>XYM+_xaxJuz0$nK3>E{Z_PEh;!SE#`_{VJ ztF9`4+-jyFk6StC2KWLg_;JMAL(Cy1OT?N-ofl^1aE*p1tX)OWl?5)EzQdBE4Anhh z?Fbvoo`|1aE*iGl;FhLrLuSX{{%Xlonx-e?r&u19FV0deDSy(+sY)P1#64s|RK=FR zWUz6{!&nDgsIvORJ#ZEpS8e5hrA4!>ynkTmENi~HNDxaUnCpwTG>;B%&(BlU?ww`z zaWC(E3rDjw96ui&WT>^;I2mE0G|WSX-!XWV1BdoP_0oKMX55^6$p?nqm^%lXtVL2H zmrNbAJ#gaOQ`TKBFApeY%3QzIosM^io8EDu9Qmy zP8;%K_laDZ_BTVWYQdv(tUeT3KF7+@(|68MRUDgRjopU)bm61+{qTF0nHvYUM0d^P|>$arqIn zQn+cA>L^@{Di7Ur<0q1#-YWT0u?+gwhAeliQ7$^zEjw3=)=joLg}d~CH3<7z^WvwF zhxWaeBXyV0Qx!DNv${li?1NT^aQi03&vGY~1lzdyJWZW%EfneeN$S2fZhrjang6I2 z*=n@s=Ua0pH1pjp5*Uhsl;Ya!Tv+D{b*@3`@jLto$bIWyZmCmi!xtDZqz0Pgaxh*>Ps?NQk zbK8gV+M??IT{^f&=ib)2cXaMOo%>MdKGM0vI`^s0{Z;3_(7EF}*L+H6|E_ai>)f|G z_npq2)46}?+>bi?bgrk)_13vQI@e$4ZqT`#bZ(H&4b{0@b?&xioxM}% z?$Nn2og1Tbjy<7sPwCv#iqo2Y zvJTAY#wT(#`=-kJ>buM9D~j%|tZj%T$5IlLF1eC5OQSPJn`GI=+uzKSSzf+(b~4$D z3!29^8Vvsj7S;;+G>g z*dUuj+`{+z6S6Hsl(npwa$SAx#QKT`*5n>B#oz|rMof_1N-(tI{tBKBAUC6pN9?(S zZSK}iz`)q5+KKm7Rw*~{7;IaUC0-!o;lyma%v>;UsH&|WhWe#BJbEr4VZ)EE3-NO z+Q~__fJ2qe#2HXiSu?Sv0s3vC4T)N{Zk0ASAHm_XRXgiu+x&8{FF$2-#e4PernY82 z6%Nd{@rdK>Y;FLxn`4VjRIp3njkYq_DkJ4PgHBvMo0#{i4b|FsX9< zq?nadK`QIiQMqQltsxPvZrE(YcvAa(v+bAHrFmK9cFuK`b)TIRV2zt-cT(|*wjE;w zlCE^22{AG2#@V@VAT5*}R;d&1>C!1Th=xjURr*!iT<#v|NzTvc^(~~gHfHmP^uk2D z#FUT5jB_?CE(L*;qLb_$#j*2a>`21&ueLHfyEMt(iASlYe{1VtG-=6y+8W~nwo{|+ z*GQq^<@PR0?cY$#Yh!f8+7YJV4`yF6++SMkR9UIwJZGU&-FiA=?=Ouj7WYdt5?nDu zvE~9vrb9`_0(Knw$TS^8+R@5nV|*rM8fTXTsnOnI$vD9tip^OsY_{38$ExfXdx+~L ztL(ACaEK0P7|r-_HI{%hI*@@IW8>?$Ua)u4OIT=2JB0bITWvR@88cSfIf>qe)pi~) z9$szdxdVuu^Fvu;Y@l8=PErhq)wQKG3c%uBl0ehiWos;H!h7BE9(J;QgvaYeRwx+16wwxC% zaEdok-?eu8tWF2*TBn0K{XWT4`iZzKEA%x56u!MtE()5n($PVhyoDUGi!ns~o{A-s z#fBGST|%e$2)~dzHzagoXRB5@y1}JYs~iPQnmKAQhbf=``zrK=sCpg(Q31Dm3jtZ^V90x}wjwIEW6CFD@Y zkTDZYgODpeydE_chmm5cXqF>|ejAgY5jTV+ut;SjW&Pv}8w0W9zxPQ8U(2Y=#)*vL zy@myeKVr4QxHTa|?7KOYQCy0p3zn94G#a@ARPR>#i@29Ju64vt$kI6uC+8+gr*Ypo zla(h6UUuZFbVc!N^@`4|BXdNj<|RiTc(maq$F<@wZVZbMV*S+O>{#PF(Twd00hOVs zm7PPQbF$+ub{3s22NLvYX*ZhE#n_#F{B@n9kdM0Wy#$18Lk^<2ndwi%WzIYV2jDAj zM%(kUBOr(C@cb4ni-~eG8Y&--->N&))*eQrwd-kAs{pF8r+ONVTqTZ87gz(yrP}AR zt+847*5|TI*pudS35Yy;CZSymPx#`6r@2&kt+8Fq?Oc2>?ub25Jv4lSBZsCxuX1z@ z-QeI$v2KHdA3_T@IAUua<%=A#xnRi>2j2)TZHS-Oz8MO*b)zFTe(6HqmDzlaY~HBO zibES6yr6Y)qa$`NLipHK@zt)nSxRThCI_!*Jip1o&%iyK9M^#SB>$Y79mR4C&E)eX z#_uM%bpA!P5-?|T`~s+3;E+_!SdBDoakywpI5C;qoUz3bo0a>?FbFwZIFC;JAY&B~ z5&7bGvYE=C&08EnsWXpCyCzy_#Y{(RIm}MednVfBg?-e2h|wRr!6D`K5TlJN9J|#K zkn;HYXc+PwaSj|7Y~31nwtR_$pN__D4oO@NpI5!iE2ykvrj3IWvtx&G$xKH+;Jw@8 zHnDC~+R_F7huk!Y>0CqMtB%;JVvtH+ty{c|eCtq_osPFTR z6m@Z(dDX#Lffg``G&Uw_g@?+=pcgo=O@bO1*1o3t32Jr@F+Pc)w+n=^kTzwdvLw>U5j`y1Hf$zOI@J;-HK-;@xhcg(HmS)c8;niKCIz z!lQ2Tw)lO$sIp<~gB3Mnd68O1d3A3%O60m*^|+&pv;{jCpGxc)JKiTBcksGoKTVx@ z<(i`a|K@1%lY6%QZ17RtqC~l+Ue+A3h2JpMy`GH|SG(&?#|Np{U+Q}s_i!W@dE4PM ztk>>(+p#YviQf=KkuYvow!^7-(}4Q%lPd48xTCzjC_YMCPo+n3!(UHRk2=~Xup0IK z!eN7vw~jhS-djR&MCEOgcyLrt>-|oz)LNeFbcrr9 zF{dWkV!DVD+GJGq6bGE04E5URfO9Y>7+E*i8I+R4Z+5nql5XmspOlk=!8C4jaKaNv za?^J=J5!)PV2IN%`ZI2J<_b4=P`pk*%`Hm8+C6fx3~?5tnqP-FBOVm1oa}UqaTghT zCtJPoO!hIb7yLsg>C6jO%guh=foOWqmvSo>oDrZ3qCsixw8X`9XjJe z=RARMx}2B;z<@8DUB!-<%0Grf3+eeUoV^7q;VQedL2=VjXJ^6k#Er9mcBaS6DZfTM zZN$TKAuTxS>>_sY?f*PP-`;W*Ni&*1akfk3*NliB{Ac76(Q|OH%UkCqA%u4mGNTyh z@e^Jd@p86}>=u^NRpt$x8}SmSjyZkef>ZgF`9OUoPb5?|vEJ%?oLf1o^te+iJ?;t` zMIXz#lw_j?XI$x00TzG%g5iqlpKdXiaNhhO$->?oKkM@GpA_9c^qO_ak$4H8%DREG zQK|M!U+U1ej@~M1T5+aYRNWy(@A?+FCM#R0@Ng3L#bFPPisMKI_$2zw?4ZrNN z(Jkwec&LGFAr^O7bz2i1LRt>(HH&+5XR-gt4Q@`;G4Doqd#T1nrZ+|JSrXSwzqkkuPRga@Tiw~>PbZMPZSI~bQ$-V>`=^rf zss6arLdb8CslBkxy)`-R`nm1yMB2OEogMSvN(w>xi*!a*8-O^W5BKx5pLV$al*)hh zyWQ~P*naoZeG>SsH?1_}c1AjjWo>ecK@POZ?UTfKv`-jnRpD%6Q*Rw#c|&c@ zeU%ddXg$Yyl2Z+@P`^r#!|;kWqSAAh9p4jdneOQ>-xGADg=>-#NHCsJp-p5I`DS>! zCGh?NI@Rp4(#eb27EyMKa=%})(*?*8V9yLsvR)vZ$VHo|uF~VyERT8iw^a!l8t~{T z`N-(fEo8P{HquvBLqMVtXuf zXm4^_hCBv%&qK5$E&LUEEEMl&-br&5m?nH7D^*A9Sps2zI8b4wa@Jcm3IkRJ!^)aOP=lCsf63;v#*qs=_z zxid}b^U%Tz$ynoyE;)+xAgaMq9hYD5l}FMbU`X)srDTlpVe_cRp`H86bGKghSdvOc zP;;KkihS*P&y8&0yNjNXw0q%2j~l?TM6W{|_KWAHSZObfv8H%cOLrxD(S;f`>Nw-T zuuN}$B6nF6twQ*HZGNWr$#!vfFQsvnS|7LfV@`sR8TJ;almJa==+=%YIocgz?_b%0 z!fxJtDTHu;8D@07R@cotH`T5VVmqF3-~LcTV?}jQO$C-Aqnf3!_a-~OXeqnX+eyXt zN7GIJFyl45=#p?qQt@m~Y*Iyrz5=lpXKvOJ4FKDZ}^1^hC8|hl*eF zhVZFQ-a0rij)t!D_7Ke=8D^y*ec(E;8TjUP-e8+?ZK3JQs_6V;N)k@2ab&Xi%!@sUUsd{wH(NA9 zN~3NK;_}Dp_tOlwIS5yGz2fZxa_$wc*Dy{qZt(uTBxaRnXy_S^q%S}L13s0Lpe=kO z!#nT-vGVoaShXVs%Ymx(X4-PhTg1LX%cBD0OEY~(y~W(oC%o5ze0RcItmAlmBeXrx zTTglmK^{Hn4TErVX#PpBWy!@9JW&-6F9PNiy(ETr=_V}wsSb0HDZ}JsMKs36;rbJ_ z2Tpk{UD>kD=cI#2uN(#stvZ`xrQeRH@D_w|bkgiAkvhAI^^z=~Uz&d%mAA+DK6{KN zjChq>PFi3#rO-5!$r!7<6Px3ODdkB|{&x*4!>m${A5^86yCiJp=Dub16^U;F>VWT%l*=8(0aeJVBGd!lV)OY`tobI~^%s7T;?jPw`Ff^9Qt0{!fb8k!b5K9GDKS~?aN{jKU40f6 zX+BXQ^jjC7ONB1y9X>2G79$>rD(Nvy(@u8ty`Aad-EmP{X?cBPB`*b5)DJ9gn4r(6 zrqSN(Ri&q|_XQGImvXQ7xnTsQ5!14}FHswCgYT&vARm(PZPOG}& zOF54C9&^uA=JTOg%_v`P3l&Eq*V07&OU!odPosP@^W(xp`6k@!l)o4P4oT&Eo$_eQ zbY*DEW6IORkNFB<7XO^&>46xb(=^vi-)E`7E<}Ac{7sqbbK4VmKOl8}0bRr#21CYc z%r=}^i|Ftg^pywy@KNC0)xP$k;G}&K#G%f5(U&BEHwM(E@(Hr z<~8tS5lva+3rdNuH1FZmZf&HB4vAcE6Zz))?3#V8@39_IxcLj8OSt}+c?vi7s4t|r zB}aXMxI5+ZR2Qgr6d#S(;ipyeQ~k=J=a2h5sDJnIxU4IkT_W}8p76!%&uUJ!YvWJ& z1`merrUJhg^Lm?8sQ3nt&@u^&2l>3Y3Q9p`5u8@|#tR zb8hLLu-^w8r^EhOKX#`T*O_{-22|kO)YUdrVu1OO zJUA9<*LL&&J|mI$a7M{{qq#&yDvuVE??wbBKH1-IG`y&t@9&=(NZP?V*)#*eu<-rn zyb1oCYz3v>Ufx*Lz+uR-2~>M?f`4s~HapwW;jfXU;kmC;@iKw8gks&gSS%oBT zz$JR&_lS(&e=1LJmb}luJ4Gt2df%U8*r}a<-~VQ+3QvrO z*zn{uHx6wrz4Zx>Q!SnR#GeQ9>nDDEBd@tX_0PN;e^+)41f&EuiP_SeI8?m96?^se z<)rZ^BvaEr~fu}Y^#)q!8w7gTGgOu^o{JTt8^{Ax_odRYlTiPLD zM-|?pfIC~6NL3~tQ18iVwOfh;n>ob!ul)l#u>$=A4l$QahsUJh^&hkb1pew3Fn7sF zMBb~VA@?fRtM83FY^CzaY1Z6WuVfExn%po@4X=6OtE#pZGnrcLz`cRLBuhP=A^}&f z^2mZ|PF=->|6BV+BrrsxWaF*$!qFH4qF1K|g5rsl28=P=oZK+55&wGNOrvv|>W3Yob zZ|oS%mC_z6ilBq5v_6Hw?g7Dqv~?;n1r&dSQ250Un^M}q^om=9onhk8t-)@hbe$-9 zOM?Y*ORAJ-stL0k#O5vy7NWrB(LpS}e4oY-gDUMnY4C3uf);_C7#-{>h5KPKB&~po zOM?#aux?Zk8ru9ZLG0dC9e%bZSR~x?njnY$hA%ccUmHxP>GfuFtig4O>4nTuc@di8ed!Y(Add}hdS-+neTHd z1yf9cw{TyPU+S5U7{OZZHTgG;$2a-q&*gU$M~*Gc=Rl`BpUZDAz^0}7e(}alTbAZy zy1O)=L-`giQ;N4N%MXbd3t>;1b5(Rho_DQUm2TFyEz5sofJOO{URqzv6Z;|+7k4oY zIFWC)D@nV!WI{z%1+OG7rs@;7hquEzw=d3?PCGrIz1gkm%DN4kDF)S4 zHWulvQ&k;afC=`y*SB~6ORRLnJN%4}@k5QbLdh9OAyyPJiWr+!Gcx$tQ)Ty10N%~* z9^$abySs-tI`rA@p`a+Xr}c{v4h;R@o#me@V}f#PP)hc40w=OT}=FyM;$UL54S0cx;MO&9w|cOWnLgiV3dVeM(AlMCm)I;X425GSV8@WV&EmFn%MBS=PfC(77eDp17M->d2^b0hI>tE z1{PQrYxngI&DT5n%v~9IHaRz<>9qU-3@dSCeR)komD<0sSnIeTv?Eh4 zovb_Y!V8}z)YmrEjg4J>m!A(gqQx9pxAcl{YrlW82W=3Tz-#5;sj>W6n!pp89_fa=BXTdBGSr5n`#CgmWup~?0qRRA}R3%fFMv~6Pw266n+OG^s8s4sBd1vx6BChp1$kDKgy>cgq1>H4bL@skG)RL8EW z{9fL<#$Qy?$6L{mYTCT5z;3A4-rZJUbKviZ4-4#tERSZ~pt_)`x~O_WcPWE!ZQ@wN zr1CD^djQsa2MV@lOT}gya2^Y4G388r0#nDk>xw2mT#1`rHKm^{a5|N7{)$Fq4?ZmF zd`mXm;4y2roh&G^c$HT6!1BiO+aIbKU(|q~u@mqwX1kCwzcgV#OSSgr?+Yen*pzxE zI#$-4xv|h(TpG3|vZ#s1w8^x;{#f|EYZ12POy97bKH6q>gKxer+`Y}(w%GiWX`|Y2 zOt=m4hi1_dGPpDGifb+H?gMQ|QmE!NWbRPXjTnF&CCcxkv>0=rL}7lrwNDD!=v4X3xV%%L$;RJ(bk?kmr9 zXn%M%+?#{49{fwVy;vCbN!TN$uwU=7OjlbJpdm955wmW;IaPFqe;W43b!I=6iCL%W xJ0uX8lW9*>f2jG>a3GQ4CNe#g>C{q=gsprC@=k|yRAfs&SJ6{uDm@)e{y!Gqqs9OL delta 93537 zcmZ^M2Yi%8^Z)Pab9X6M(nA`A-V&ut3o1w_VnIO&9daZjgeHO{A|f6EA{(+QEeg_0 z6k(+%7F3WD6&oEJ7KG?)FYy1)KKon}_5b<2@4EBM?(FRB%j$_k$ zN1LZ)Gi&EmQ!0Q|wzONkDVZ(nmux95PGmpa7R7dTaPhm}42xycqT_5appwR?#e_we zN||SHG{5F_$Fb|TrJ7o@$L?wwR$A+3!^WKHGbZGg7W;zDXy7r~QzsO#>W&RU9R_=)#j(uW zKNdoK{%m-hx%d{=t8*mF@8V)tJ4CVDd!(?i4h`5#?W0)cz$i$u74UJaU)M;xEqm(t z2@kW(j_uhiU0T}WX(aaawrDhJNGrkD@vu;KJ+cAo(7ppVhqzm?{0_0K=uS6#?Y1;i z0`qi>WS2U*JmEneXN;LXWqK*kcez`$+dIWJhzMe6k~w)}#*=8}Nc`?QywM;O1HRna ztTB@c#!Q{T!aAjx^mXobmxJwU-`18&B)E5A2&q6LHf=zo$kJl36mi!03Dd_FWarPw z&YQ|kb#BE9dPYUo4mmM9XTo$TMpoFVrKvIcMzQPt-Jp|1^JD3~9W1O{N_c4YR47PJ z&KM#D?j7!ER@o!kspaR)oCI7czr_~bgg>phZ#9DjlJBv>;cQ*^R8us2zE5=X(&E}t z3nt{}P0yZ@S1_lv*gc~lZ{}EVF&VQbeerZnX4TyiS-URHO%Wgz5mH+0Fl59$JySi# zvPxwnohL?Db#(eXMzgllK^zJu8Eu6nX;EhZpq4q{x7-@uJfhf}2Th)pJz;j*?7V_0 z6La!rvsZei+8?z1-~SayaMQD4QSmdW4xQFjy=?(h+&`bb#lqMkSxSaIju8mHYSmtE zHjVYnNHDEt4`np+4W~9vsZTm`5i7}vX}&>HH@MI-qv%_RlC1t|BRiE5m5@z{h<`{- zZ?I!UuO!n;EV)+$QvvJRD=GOAYU>S3gp^BfIfoEQq?z24Y1cyJgm%)$WPEI(>8;kY zDiADX7kf49T0+RkT2f@h6AJWpQwbLx#04!-$IfHDZcn{q3bm1bNV<<&rPCX&t4|_( zdS2Fyyu6(0I(98#6IeLRs`7Tb>2dbf?a8KG_SNl4uI+?Mp|N>>?})f~Ig^L!V`z{e z`R!%a>y9R!R}!XH3w1B150Xcy+8HYK(Q$j(+B=%Ko}w1bHv z*IX8UXI$f_sX?uOlB%cU_YtOnqzB&|$+GUWnI^ExI~%}xMA?@SR(hE52~)@AjF~k- z@3jXl(oL_jnmZfYAEGv}c4?*IrWaVx-mOgmmeaefDT}S@on)HM_V-Rn9#74@hWhFb zTr&R(A>vtiWHfX4v75%R=swBzeEJy2O1i-p;^SyGtWQJxqx7)>`ynz$DaR7Fx=%yX zHg>qrZT2S#*--5}j!>P?v9%w&-4$+shQJosZlYP@ZEi(mKbv<~2m53~HAVMmcH%Cd zX%oA2S4;aO`j|vCS9G?i<|EiGeVdyWu;G2vO%-fO-xl_*)GCGj**QTq$zkXFHc8q= zpQ8+m3fi^K*a4Q(uVHc#HHlURmIlW*Zi?KQ^fn{e=zh&jyV+CyTH41@%NFcnmnQ5& zKf8SffiRO!hM8~{+CSA)$kO|_w?9ir+B;}(iBOVQN*_C@kF?=Lu#^4m*2nN!_oCPO zN1L8!>juWLqyd9WCL-MG%8-FVl@?SP(eP@|0WfSs5n9eIY|FoRFGTrzfHwPD&C=jJfi<76+5Un zW+_DZ5>?-&qJWCyRFFILpP+*LpZ_EkQE`=u=~R4A1-TUeH7dx5_^(qjj*1$~{}uk9pL~e_ z2P#HW@go)FLj3=uVhI&LQL&ARpQ#`p;{SyTavc6&sUV->|BZ_MRQyf_IScRpU2&%22S|rsLvN1y=Mv$TVV+h_%wOFdnrdk};$iV&aR4b-h z1FEf{S_0Kxq*@}?CQ>blYO|=8Otme$PYn&XNRtj|-Tj^ur<&QN$_BJw=X8}&0U8Ii zjxD=Oh-@pM{duPjJtCo>e!4^AN+r}K;Z6yW?FF>6n+HgU>@T1l_-?R-$npZ(SI-QQ z&{R_CfEIpwm;}iL1KQ6C4@!v4FreM_KOI`9<7%=bj?6Kj&3}B1gvcTTTHC1;B}7&k z&`uA?mJnGcTAK1DMAjM5c)kwhkxL0^v;NjWGSh%Iw`_)NN(LIxzWn8336YTow3eHT zBt(W9(0a^yOhR)dbokmT36a4Dv{hZ!Nob#hruE3C$#v3TV4q>L8hN zKpQnphsc}*+Nsq#L?#{3ejKtMJ{D9UzONYq%vG&jF5P5)rHu{tfkrN1LabM~XIf8)ZxP7}E zf}BA>dw!x0kwXY*jrZsfIfa0>{*(?ef(kMG4%w0XL_oXss1A{@2x!S8c1j%ii-5Lg zfew++0MQdVM1CWn4f&9KOANh}fX0}yGhy4FQ7e8=-4Zfqa@g}iw=>)3TQt}(IMIq1KPnybckG7KpRt~L*&K++F*x}RI(-X zSO*>2A)(KE>kzp)=*3taB3BpCYL*r1Ao)9h>vf2HUO>D4nhxnE+WRvddP(A5uF)ZK zgaNH@-m7wWa)trz5w1hz5CdBOH*|=cVn93brw);03}|Os>?@QV$veXB{o&m&`z@5vpY3&Mv4jo`*CFzw0d3n$Iz+xSp#9&; z{U-{^>ybmn`qt=3a;gFCZTA65lpJe7i!9M0a;^dG>YF-54i-ika!|G;Ckq9>O^3+Q z2DFp+>d+PmZJ#BfnZ=>wC*)5+_F?KcHgrT+)5~nxhz7pMwr$h!KRQOG<>XD8giOZ| z{zP^Jar_4bacunP6!zT2yV;zDp{zW|&Aup$WHlo~*{BH-%*rAy*^f+Mc_W*!`<_5s z^ecQSlN7~PD$GBSz%^kggMd8mMWI4X*j@y?(d z;-n+!^ce+X^4YGDu`GR52pa)jhLl7&OJtz7ytFy19&@YgTRNs8JCPsC!pC~pebW*w zCH^_A;n=1cZ7I}l+NcKX7k@1KF}HDWwnLweVt48jI6A-`EyE3WbjCw+%heig+JwHou3S4S0{I27Yo8n?a@AweK{!( zbFW>Eag&nR!91tr?~k>ita_ZA{jn;P9iJQ-T#-H5EhS&~kMgnWi(Qhxag&-!`LBG! z#}2ItH#H@0Sjl7`%bVDWEnCnV(oez+JgjgcQZ9a%oJpVYomon5h@4UTNonk(CzDKV zRZl1Tb3!_#PTMZc;ljASvVUcc+xkd$eoj!SNF22E5F3WA$Vp;XL4H?G8oO_G16H2j zhJ`&F%C0T<8Qs~E9GYNH5T{)n#8)iugIP#kka5&Gce4GIiFk@yu8#O6a3Ubc;cr#K1y=F$S<#U~EE@Ya&D1j|n z?bdtN%t>I)*MzaKxuNXP3Qs-7*gY+U&CgF|KhJ3_m7`!nV8y$UCC=D`HLy=u%8ztvv&C{SaHE!%$L^!29Sv5i?HS9 z%|zbs>6xwBhfgN6SyLOb)encVlqVf*9(s|wJ`e7O6?jQ)VJh?3<(!_ZIxB=`h9u-m zv!ht@ET<_&)*hR6C%b=jJbP>A9cra0h$1zp9utRgJFtVZJ(j$2+3fDs$>!q5=+wYI zK5yI!CUv>;ZlLe;}Dwy`q`CQfJG`MsH8 z03?4h%0_cWYVF9faH7Y8u9zFfvhrXX4~MYKM;t_wl|SN=n*Pq%P_}Mb2%9&@$;xIn zV{eZQBiK6O;Ti4Ow5d&?R22G=?#)Y(x@4$uGLa5@IIo}pNhUd1t@c2fSkIZs5K?gX zWHna`9civ9E92P3BBvx-F*}s4dD_GNn&)Kq&rdb1guS|$zQ-}!qw!M8;~#A<^{#4O z3QJ)vq_ev4XgGMJ5L8JW`P`JnF)Y8(At&_N{6>t}iJISwB`^@OiifgbDI^!DCL89e#*fHJ{eZWv>UQ*Px|CeXqYv` zEzR-NDv$KNwAU3q7b^EQ(zX9R*_u2li+nOt8lNsL3jB#9!x-*d(#q6{U4AN&EnVVb z*O&R&sz7ibz_kr9mb_VG*xhhCr2Ka-Nn$OE!q}BM~GXo#ATZ{E^qd&tYmCF5Y1?JRwGOrH-XhGYRoP@l}3AN z9gbEO`_MLt4PNTRdZ*}Pv9B7< zXA+aLEmI4&^wAhLeI>G{a1o;rb||6M^SrdRzqvBjN}D#jdsIx&_12AJK6v`pVC+Ks z|C=it${iDKmp!-AC9TI;cXG5aVOUX7NoQ7AYG>U_;moDI(1EV54C-n%MPc{lc4o=X zG?MYjP{btDM>dpGqitu|EPZOF&$LG**0A1$UVk=@r9VfGT;EcvA8NpULo7oc?E<#7 z+j)$P$6kNd$Id+Clf2L1jo9nYHm=8~6YE6BOyZH;JjFxnpx1f~BI61~WBPX2r_9He zP8=1Ct1`xfB1(&7T~;Rs`OxDNqDsfrIx~m=oVz;Sk~1rp{eX?Ct{jG~ZH(YFJ!TUn_IB!`0vU?sjOt1op&B&Z_3uJ&tP|MNnNoa zmpRd=WW!W;aBnJa6RCxse6?9`_5Y}JlbezLj4&M!HgDQw>648~rj&J$Sf zh8EmY>1@tcZpmO@Z%yUjoNzW|aa-X4w-c)xA9jb=!#^D9jAEPd_2BcVEM(hQ=6IX1 z$aJqy<(`2d9oW6wGuZUkQ~B`HkWfB&a!3^W1YZWPPi57+Z7gHQ2$sA_ufKu%n0=}I zsj#pX%)c{(rN5HOPVAhQJOVU5^3_>#Lnm9=_#GMn&PDqnmE)GxlA!P;$3#`Q#P?Ep#Rp+g?E6zn#jvbq$AqJp{$6Ol7Yg%44^_lgj!Z9>Y3eVNM>N#d5c$ zvPqRQ+1GD?p^4$iEU7Ak-Pn-Ix6cf3&b9z}@cmR4`r3mm_E0MS^H6wOw)eFR7Jej^ zKlc`Bw|hN<^?@&KP!7r1Gm_?sT@{Xa;-e!&Igno5C`%_KC^3 z=01EZgN=f!Uufh`Vm;qI!2(B8S=#aO%<*z6zuv;#kbQhSgM9&BD_Vhu|3rpKFfVvI zd7^+VJOII;!ajGx%BMIYL)a512eM{|Q+NM#(q&>(Ai<;U-L2Tb>I`-X3bU(vDq9S- z%y@4hI}Js;@?HVs8&lc5_e)s}l;QMHcRM!m1K27&!O;(9u&b}9veBofvQX%7_Ha;2 z_%MTQJDkc2Kb)^$Pz!rp&I4v z{9jUy@^$_nsYbav|4phl}B7w4ZuHOj;JXHbn&aQ?@rwu)-Ys79$b|0=3c+ReY2YLs&G@1Yu{+x)LnjZ$s? zQ>YdCDbMCVM;|H2=KqFjlwR}yLN!XQ`7I$RD6QuAP>oV*{zR%#I?dmbYLrUzccL1l z(foH(jZ$d-yHT52Y@LxeZhGmXrOo{h(#O8Az~YdxGjnow|NN=j#B+ZS^KwsrdjxBK z_I1;PyT3bo*vjvo7@miSBA(rPxi24?7p}M1z4mgXi9jE(8EjA5{n=+f=-}=zzgVJb z3%)8h%O<F;#+LmU%JXvEp}V)#9Ix|z z_p%=^tNxGu^ov3i&D9*cpZ?`e3k?>@lY3i3`Jr65WB1>`7aC1QTeaOQ|J<&?BPLVy z?(DyhDN?;}PSqI|Kpa$UGX64a;yH`ynu0H-n>D^N%ooXbT1<9+IL{rzKXID8;$xd> zpV4QZP2<-iOm1G3?+z7jYNihr20S`B5A*qWQodUgC!D5_3`}c`b1=j-PO)%Hxak#z zT0Y&Pi5qUyc?FYXc#{IRm!F>oBB4H$ngP$izybpgkTSrU9MZx`1{yCaa65%R#`L73 zQL#jGiqJTdA=S!0VH%HVYl`6&UZ0bXp6+&wlm@0x4enN1>!Q=+O)j3|^=bTwhN<71 zXsT2VYaTagqII(AX9bhE#BB{t)AVWa@_`T^#!2E|Z3^{?pHfZFtCr=(VVc<4#B@`^ z=}%f@%VeIhG}0!%ZDxq7tQQJHrwqL_#NHNM3W)l*p?heI71e)V$*M zE~ZnePZ3FG?Nn2=$mnYNReda9h!xB1ZVFc{fyGG0ZPgf1TH4bT!b|45L&VWurn9P( zj_KMoN_>5X>0I59+oOHa!r8}kL4Bmf+S}LUs!MX&J;^S9X=zM|7~H>pZ;9C+;|mpe z15Ji?t!v}ZMDAcyjG_S!6Zzm+UxGN58SGBe;Fv}%I=uyYyA_wU49UUr7P#H|g6thxzfXBqQ1%e3Pj$ca9@c6{A(#n&GS(~N#~Tub zN+oh4DbgmI41bc6scE9eWK)>lyKE0MH+&H+#4{agvf~LD)Dr)H%%pM(X3}A(#V7XW z)Ke1yH8JEZiJ#05vIZ`j@Qf!xGiACVJjvCiL|?4vH?yvmG~vrPGz}AzXa9%dRxfrt z`PzrU!8@l-K2bKubVQfsKiIFB*vuiGn;SIn+J(prKrQz?YPzV_fP^L>G>;OZq3|){ z`^QYm+Y6YztyW9|V*2}^!&Vo&Jz~IO(vCm_q4B!?lb2%|UyIuoHRyMw4Ca z+G_e%5hkBd))(`yS?P|`=l|n&qc=zIMxth?v5SeC3R8&ArlA+nMA62JI5w=VyA8(| z#EOhP!IeungKlx4>Y`VjKKs3GYp_&o>LQX z$BpF(iioEjhX8l2afkB6PEfxYCxhEQSv!X-iPqcXweltKxgTMKt<}L1irzQbmFAF7 z71)Q=j>e_-9{k8;*72LFKQXD67k5IBzxyAw@#Y!R7it!Ak{NA$F}!;xjM4GDvCB(` z^2wyASRFC^;y;~3v>1HZbVVma^AdwUH~pcg)-K8D&oR&Cfv7M(u(8=I%DyxmQf+8= z7dcl9x4>&x;{=+EXTJ%WH|Y?E4&ljtAj-wthk($_-v#wm?uFGG@VM{jX^8Uu?@e#l zot#vP%op7e;_P+9hx4EXj9d~G#{=KFyu$aRsY>-DNeM{mhQVrZZyU1FZRZtBqP!yQ zm%45?kq_GBjuu0H3vMljv|~i(AEvJqA<1gb&1gCIuljnHe+zcJs?Ba6hk|;=#v6uz z;l{2Qy=RyCCq+jZ!|^R>{oOpLSNv=?*HiSHw<7qE!f@KmuNh+pwS8$emgCuK3=^Z7 z|36j~x-=?WC*I6yuIm}e6Gn^V5VN6h?n*=l-NMX9&{FGsOWOO~Vwu}~T5(W|$=HFA zvD|Am0;Ad$uGryriOmsaBbW?^45A{+T%!opddpKW=Ii=L0Zlf-L4%x6{L#Q{giM}> z@I==V%~uT~6kS69eEeKTc%rvDy1gPbCCHMob@_NoCttGY*2w&U>S!o;wCK?|NKGk} zkC(JGTX}=!hE_e^)NBOYSo}C0y>@a`G>5Ku#ro#;7C^v_sY!~W*5(3bxh0Pxwkqs^ zAhd?Igl9Uy0d`C?Kci+2x&EbilSXtU-5f96?aagKbQkFUhH50&Va*<#3CcT~Lqt(0 zb9J5WBD;&(uX^U^VQsH=HSbb*I!%aIx(8)yM8^^0Ku@?v{cuzUnQdyUt^Ai!FW4>fpvRBC(OCy=Hccm;0MlxGUg5411ty ziyec_zbPWs2^Q>8S!Ne6yeGlK|ICKKe$OTbfo<1vI z{!M(C$Qv2dbg9%I4@Ha%bfj38RZEikEI*v!)hDuVjM+Frd4xGyl#eqT5rZ7OCc_ub z^AEbi#K{TuY5X}6a`<{uP?O=dPl}0{XkLun>f`$(hgH11njohqsC-9lW5MA6i&upB};gh5JjY_wR zXH_A39ymWZAPJHWc@0s(&MF9Qcu~C(AR{mTyUHEIs|Q08g$vBaCMN9-isz=zksKoQ zil-Ku_bWlwG9KF7=N0o7nLkz-;#7ds-xW-(iKPLvaTW@$fZ)YJdBG(>?#(Q2e(800 zxY)YPe4=jmbtOTAspacLA1Kqo74=&3*t-zWj5-2lKP)vLRy1mdJWv)S6tq0P^Dcxs za;dL8Q%?bT#hciBCFbYn>S4sW)#lIZa(HE}Ay;v{+-#gL$uslOCm_UAM-Z;hF~bOd zf5B{INJts@sD3_=_;!QY*xG}tBR<_|cm!TMgY%n%1J{ZIA47P`R9KQ@|T4mV@5W!*>kwdG&Rj^hQ0c z7Xyw2XAqPU?>X2PCH!yK(+!bz^xrK-_Pgc_N?>vy#cHY0kL&O$vvIfx&Y15QVrb0D z_v-7#ybppKCmdq5DEZLX_Bgh2ji3J<@-07s!YzgKHA>g`q>?3u`V1qZVRFfFUEcB?S;r0JXxjM+nc?wewN@ zd-<-RK25aw)-WZJa@B043rM9!k85TlnIz$in&4hgYZ3e3L!^}X<9~SOgZEE8GVC{c0>;H zw$c=L-S4yQ8Epy1RpdJHEn2{EjestwV-Yz?&-k&MAWEI;&pRHzW)^;i=KFpOZbmQcup zKHthIa6V^zmVa+`hd#n~?#O{^eH3XiVjW|{ar5wx-HE*U*FgUmZBa3|j32H(i1=Em!>NmmcEOKQe|{Z_(}{HQV>?*t#tfooCyQYbwI-c%&K)W4>r!um z_-5w=&f)w6L-mS>yIKw?!Pc&(Y;)`!6h61R#Yp|sBWvgWEaX*Y_q43i<6Y7Cc1xKe zgdDKOo81qIe{qLpy+NIF=HOP2Hw3V=W8yIg1_R z$f#<2l}#}8O5{(nY*8~CxEuj}_+u8k=;^npSYDi(Vi8JmIKo7U9l1euk?^*>dN4o! z1@a;CAokWYqo=@)hOzNUt0|co)MF5d6>DeLRWD7H%n1rbIxv7dYUYT@=PSj4JNZyGm3I$GPZ>nYUbM)GYkcZAxM0~@Y+W5Hiqs zXPw13UXZnj^5-psmAqcGtTQ;Io32+k*7|OWiuP@{G!Q#CTZ}MAYV*demU=rU8mUCE z9=G(#@ii1*>@=1~?*F2?!srBlrtv@bS{m@>H4u_(x5c=Hf`7vO)hm|&=`2x0frc4% z)p*2yL*oTBeyiS6Y&&F8XGo5!mk*kX%c#ge1SZAFS{?^?R(tkKz596M<#RLLA%T@zWCEZtOh zqfsZG-zp}SpSS{riu&AQoIlI2fJRX`sHcpJ@rleYEm3tk3Q!-Q;5Ijqd!49x^p(MvixUD105Czf3>75)XgjqB_38D_oRsae+1W7=JEUgWoe=sChmphF1}%Dq2TkM zXxg4*)-(l{V@Qr6oA4q2nC2qOVl_@SBy9m{H&QKYrGL_Hjp6t)qfdOLS=DwSK6P5V zsFpIT)+*F$2%aP>AlW_&kEX48W+?8cs_mX|UaomOqJ`ILm{xMBKDAqUwdO&#F~Vvb zYEC^vbBVI5El;LhMYmY15xG$!i&nPR$vmuqYbUbR*#&xLkvu{MyRRCgf~{m$=8K?B6xaB zD>9+$V{mEG#QL|fs!Flywz<^QdaH|Z+boVHeDgQg^mSe9-LZqRR{`^EO?zUGCPNO9#>t8omf21Wp5+~Cv> zbhEwH!Ar_YKY-jU=m#5dz(KHtG;nZ3Or&+Q6eQDA+qkWt~A64&mhA3S&dArywUxmzg1ll$b++p z8f3joUr{kN)2j9e5kJ&w#G4tFHZRYQ@q`HLy;kFJDg*6_F`g*lx<4o!8D`!So23`;JkdH*2}UL~cTTpd_#KxVh?>UQB1F00YB(`siGw8}w=OPPZC|AZp3c zGKybF@T78JyyC@~#_Efr*;aLd9psH)O!7FnJK*z)kLDPf`%mn1aX#K48+PiNXEnlp zsVY61*dmBREdTZ#hH5t7s&WnWDA@T!FT_Rh+|SXZf00$4U-X0urV%T;EeP6~=LHBl zGl0lBbD>pjhh=|T<9XguN)8dWXI6; zn1bZ-#ensM>WB+vMc3WP6DtlBThAyA1eMH}H}XXCw3T4`yJc463M6xsP46Qvl?3&w zRu*!w9qZ#F_|h75Ol1ES$Twwi4Ft#<8X?{GAtyL}aG9^A$meyri03K0tyW&S49D^1 z&stURBVfjca!7-RvP4iz2QP2p!Hb{O5Ysc&xJv$MjnznM84`)%Da||~JR>Jo6MwG@ zT9tIoPp+~y;;ov&Ez296_AmTL@6jc`2+?DM)j01-bMLy*YHY^ftr4$i4(D@nEL3LO zW~&i<$Rzaj`)o0M^wT)eAJ}UBP{|uoO%hext=A3tgGSj-sPX(rn@_lQ{ZooDyl68_ zC}m?@m`Hdj=q_rfNa!-=bMW|V5a_$xY8>6=h1bm_@SvLb_>$Ye=FC0+F;zK8o7Ntu zC=@~2=kE(T+oHu#hRoNYMWe6AYvPjw#%8O#VYw=V7B>$Cbw&0mFZDIj)v-@ia0P~} z!RFchb!%H?<`gLK+54<*c-0$LFaOz!XG*8vv>K@q88^K1mbGymFG02+p>vd%?s183 zM}x~$%WKi*IER?}uJs!w?2FqF)a0MA8c|$uTyf!)RV6Y6Y$aI@L;(uFb|*xb`K~pD zyYu2=bekM^I_NJUq!zqzOPpKacG<|c)T%0k;^tND5eG<{6ra?!uOyvr3E~E^|4h&` z&}}zg{4DH*dY5gD^9gh|_Ge>yZvOq9u|5%h(fUzc-AcJ^4JN}eU5@EC;+HyMx5@fE zxLwrpm(j@+&#RwJwF>@aFy4|6E}-bK{L))czWhG15xlqtzUbT)t8qpTwh@=UvD%ct z1}uV_6m{`5)o0uH>VIfs${O5tF$k@FqrVfR$*$TX#i3BxQHx z$GZNk1+M@`oc-xPY{Ih^XZON2$Y;ri5!$cyg)Y%2*ZAzZ-6s4V49ScQ7Y~ls;^7tS z)+<{4X;l|qd;hlHG&Cu=xmBIBhKaPBRwIL8c*q!zk1k%bJ5S`8pC(q;j#1N7m&4<4rfoa&B#sS$`qM}Sc6URQoPMLg-Fz;1e+1B$&eE6OG#WH zm;0wKd~A|Q{O|R+2pX7bGxB64c7aV=y&U7UHk9!q7+G2Z1AV4hP+r*f;yGbNMGKp8 z%z(Zn@uZ5lIB}uXf5UFP<{E9Z-qtp9}oA6&xY74|7D!zgCMpWnGoCAyX%Whl9ZU5du+j= zl8!CdwvAVwQl*EDvc>YAyW?yk?E#xQhw$Lal7PXb4@;}r)-+v)_A0>QLl2r~VH`0g(?J89Zr3NI>m`t0JjiU0I1N&M1% z*l!9WvEHq->#lbbUg&Rv2bWW9b+(Kq{Q6UIP674!_wFS_vaY*)4McvP?LEbSOlRR# zVw^o>R7!4;Cq00(#Qf837aR`yBgzjHsAxGu~54&9AEPCG+!zIKo*U zu^G1l1}2h+?u|p1Zl2AEXJv{;y0@a?Q0?JKVP4T_zRkE!mZu}AzY%0nB5>~ln{oET z4%&cMj_@?pj}7A%8sZR8-Bf)m6KG_l8;r9?gg6BPRzY)<;*uy30! zc-?>_v8dS|oSNC8O+{QFhe! zvkr?j@7mTVl+0W=J7tR%Q%=~{D?C&knOoVFSQf3{v-P#;aL+NwCyn%bLPhy$+heMc zJjvhok?pX8r8l{9$QQ%or{FLIZ-U(6CpKJ-NSg9iI`#}X9|=?7DB7GO4=G{Fs))=B zwqF%qieU65+e(E`>}?I_iMbw!Nc`M3(!?XWgm>f>U)aj|=Uu`Ziy2?qVog-_iZx%^ zrkVKV&+(HN{l~J&{DrR}rN6#Zzk3nk-;k65D=7{AmLdWjrbJEdRohAhOST(aBON5X zsJTw=Mm8mmd4|vK;g_bu`L@0dThv`YlFO1U+x%pUQ!Q(5*qZQlN%3w`{0n(?*^O! z4S33IxSb`DcHANdo0Cvec+HzIL-~V^-O+Z08WK(WD8fGbSc?vqtaj2>iY? z+e=gtaVZOpQcLH#^=^%l0Hl zfu+2m_ZR5DT}R2+gjg1rXnKbo4ny|bcc=YTHIlr$3G}f)Yv%Wlbk4*N*^{~GXYb3? zU&7q+>$O%Up8u*dh2Jn~>W3w>2iOOi_~d(ZtM6j`=6xz3bT7>R*dRMB8da~jKG=>^ zIaT@1BD~B3i4gjGz@cLB-S#DVBc9O`3b-xL-b^IkW8b4bR>a#J{KVt-*4*=9yhq^2 zGT$l8r9WK`(P~(baEWGhh@1!QNGQpH&V2$)D0vyHd}*O4RlGlfOh{rbY||X#_((fK zS_u~|a5#8wnQFvQFvZBKHH9XOEw?82F(Xg39?=F z4W?0;YllxEyucX9jL4=L`C$%mZd!20lCkuqo@Tt_Y`l#Zeh?qVuRjbmFPLFR2q^n3 zU5?RfmU~k8pmXsKp0yMk#->?zWRfNNuua2d!ctEf_bl^-3G_xftah-gkNn4A<)<;& z)OlFE{73DG@#_(4#yus-OYbYRV@s8ol=ChJue4|(qT(?-f;9P&mQ`R`=UQ|)&+1ZI zk^U427d~lUs=9lgh5}T+0nZ5xJd*4Vp~Ula1`l8IeFJ5kpb)JTx9HG~f6uX@W5zz=c$U1g90{Ge z@f+6~L~+a*{$&;U7m2CqqHA-w&S(1d26q1OV`wvDjU9omY*Y0X)_V9l`x0FW;+Gff z2!AB1a4`gQbb}pXnlTV&{G6u~KlU<+wA@4z4omNy?nJ(EoSC4SPh)+(D7n99B0o;(mD_eQjGxk>E!}sjF>JCwK z&fcVKV}i!NJ_7an>H~@xWIyQ~PJU=dJR)Jkr-g9p!iQf*CQNQk13w|#pf&hGfgCBhcRJKkRs_wiN!*hq=pJ#CJ^qn|Jr#Li(q7n-c;;&OE1g{F!n)4E;=H{Vx z%_m-QX-ES~g6l%HcU6~~dAh%h5Nq7pC=)Na9+qePNtq~K?A7}6@*mWX&c$zD4eSF} zp>?+i4WYFT)9;ycd&9i5qBIzh{3yeGTZ{%*rZ>6{7i^Ew62;9}4Zls0AN42?J^9+* z2p6X$Xb`Z($P7Ygk_G`wm|`VyEm^xq^~9k^ACsrO;<1UTsoLX4PkQj@YNA2?Wlx#r z>yxI%@rS;{;ks!v?OlbD5v{9*h69~!DUW{n4}zP)XZ&D) zi(NFhWciVfT>>9}SFnt?Kk2UhX2A3-BS^@>Pj=N}gd;|T4;Xb0CFm@2YB9r+8otf z9u%8pYNF&|M(x$(zoSln^i-4c9k<576e3`{y3`LG!0RN>>~fFz>{;az|T&nWs@IE z9@Ub0@lSYxJ~M!P*vgq2T&^6Io@RmA&#EE*ut744Fl8TE?v1M<0G;#U~GA)UawyAAs>(Tk^bFa$ zgr|-SbJJiRUUCd-=3b=*RLiQ%W(N^#CO%!Q;ZP@=W9O6~oAdJD@zUxSYp7S)*J+3) zBpR`vL;O*$r77ytse^`Wjve_0xa<%AfEkvpC&9=*IBKNxi+|vz8K-9W5cyF?#Ij@0 zKaK6}>rEP74oS4!EP-w#u5Hl}snACOLPZw6nzu`z{(CfM*jXE zB!O{@{Nq6kB60`U&Z<7#{dzL~-p3?NV(Uo_5s~aYIx4hoo7~fg9V)76IVGB62c1O5 zYsq$T;C)(CiCMSM;t*R-lX*&5MipQXAuGWGksG3C9YwlV`4`&U+Fq17Jur%c8?s zS3~eas77c$^%F!LC%+)0lP&WT9T9x~w_21~`jz&Q`ber-7KYY9;5UDtB1ikw*BYW; zowx}S92Dya5kTX;tIp6N4UY%TVio@UK1ke9hH$?82hAg1z5Z`yD6>W24)g~Nr*cV0 znk2*`yLkD%7N)mcOh4S&_1P#tM30mXxp)VZW!TdG^idAxi{ z_!8@kN#NHme~_sM2NM`U*i25|wVgKCI15LkmTbvg;CA+I~X%+X0UQQkNxt-@6}RzBR+f%rm> zL_zM}mJVddC76C0f%@K74(xCemYI@`Z5-oN^R=Ia;@Eizc9rrKw6XIo4nzgAWnpVr zT*q|Gu;eS;@j2OA=&u0%nITNy0Zv z^}$^H%K8wW*xbdDuUeM(q`|(1i2HPPtW_VEKMMEocQ?m#X8zU{Js6RH#c?8E_cc6h zS%w217FFe8&-8L2c9gK3)xod9_FI>6x{J8eQJ^rFa&eGZ+uH%hAzR9`?)gEE1it1Q z9I`6!a#ZUWQQpsiRIhAAN+S*oaNsRxu#-S1oM$AQ-UVwAp6SpOEKf^qhX!GZAAGMP z$D+5FXZ_IcJw9=Dm;C6j9IFQpKSgafAfM1j-xi@SY>1f2; zOiKyZbIaDz4tShkPmZ3AglDYdrkW1Uj0I}=n;Vc#gmhfu;3UU<)hVGJ*6N;Y$IA-7 z)Bx-xO>uBFW^N{4?VyuWT*!44DWZ9Kj=idV`b5Z}$24mH_^aW0@(*(24{SE(Q)f8( za_yjTWpQQ(tr}q8-dPUZEK-fy1wm|_(>mpTxI z*0N<_Lh-UH#lyRQ3lgpp2X5b~jllEy+Y}pk;2lGR@XK!IaEp>s2a>Xq5N>8ViNj^2 z6S5OtY`3e+yX-V5J|dhay#@0ARSx7MWlQvIs#?ml{IYe9XayV6zlEo-ci8#9;|`y& zzu-8n#`Fvg!JEWOm|OJ?&#gS<4-oFN!GVZcvLs*WwB1OiBw?Z^u$Bo5#=vR(#QKyt z{oT@6TOF^dp7I8zYCAbT*|S!MYK}Op;-Lx$;#P?v^$}1Xqy&OvaE#&MXc^1%&qJP4 zU%I|R)=zB&))L8g*&Omro(5Rqc#q%M@Nx1r~~~LS8Sv=0J2O31Lm@qHC@=62z}>7<_T?mBy>jrbG)Y z(HE)@grxd-&ZT(8L+>~)C=4wY$6~3erZ~M3V%ahBF>)|t?G(D|UFZuI@GFI`T{{w# zxOCEigVuj_%sfLX`4{Hg={-YdxWQE{FA4Fg^_%%Yz4hZ*KQ;D{ODUR||DmJ1zMN%` z;WtX~2rsAs>1fVjg{^qI5ZncPaK^D-VPMYf_=&UN{Mb1ME*T_$^h#PByx>3%P{K45 z0WEB%VEOBlw9g%QIWO_@=^n`6!o><_wAlKkAzOi;M`YCL#L=lWFNyFv_;)Lb0?-O*C-DIkm%iU{bn34a3D2>_TD`cod;AK znc#qw@k3yX6C05nU1qYbTb+nyBrH=?@7SF<>tvk@%?tjuV&v7~7)d8!- zKt+i2Zv~IO8WJu}ggFt#NW8q0f7I>7(`3CpS?5Tv^Vhm?ZiEy5SK{T(aZwcZUIOLQ zk*XffP+pVhjN+9IykY!-!Pw(Ji6Mq%4|&hnppml)@0sAWiL-G|L_ZQk7k!)FZJ=oB zzX+e-*%>N8>=)HWTK3IkCnClmH34b}XUJb@H?FC)J$YnRj$aT#$LOa-p7d(fgE3^Wq#@B zY$Q7Lbs_=v4+){UjaPJt@bS?L8fqe?zZ3hNY$JcI6FM-c1oEmKiWACf`a*=0xgOew2SS=eq}-h`}T*e<`?sxO26c#~qSci6;Epk7>EwBTw!eq49(on@4WeYv}h8RcMC0XKs1J= zd#(WwJFzK9Jf*J0{70PlZIgs$t^+LMZ+)hFqXhl{R+>e}$UG6rhgaX~wTga4Wb@QV zKu9=3%kCr<@%H1SwGx&`uaBPyvSW}()~j1Y3*I+?8FyYxeo#_^KoH-{o-(0=$;;sy zh~dRf?B^0gV&D*ij^W?7^M>%h^FW9#a~{*%NYQ|eWL~ixBJQyRYq!6IoTH>5lRyxX zq!5YwwFnnKydN9Ni51Qxs*TKtY%8rVs0(HP5|pBm`HVAC^ncdbUYC}@@dmc0k4Aa2 z%(c$r3dUWggU?#!^pDLg`Kr#|Wd86Z@c-lsPGplLMcj4a znt6j0i6IHsN;R{Kw}pTnAw-jy!+mh`zkjn6?_VT*>P?7abgzh1zNR}AREjNio59*% z$VoMnX{lDb@E6YXjxzNKJwooO+!-r!ULrq5B*i1Uo%q3qq)vQs@RiEfHfa>4|A8~t zUMH^BB$|%CqU2R4GX4^#1Fz_?--+8|3Da4Z1CA2W2c1ut`JBJ)GwEL+$mgSO*c*!t zm1MiuG)?WVUssW`NLW6Lk-AybJ0euHe8X9)w-opxAvRIjsM3Zw@Z&d~?RnNwr;T6e z*(jVRJQRX=?r+oPDBH~4?euZb=+65)kaAgg)Hy*7F=QW}&FSi&;dP3{_nicqkF<7 z<$Uh^R>34wk@uw&7snDWfAo7l{ylh}e$^SxD^@j%( z<>1!KkM{G%i>hB~86-w-mskg%&fQPHJ7*~jwo3<}-QU|t$A~|jD-{bTQ=aiZD4edyIe>WO0-Ob)GP*X2DM1BDAaXY zp~(aAtCQ-WJ$&Hc2nXLh2S4%H9qx*?=nS6ox}H&eWFBN`gzK;|1SJfs7lKAwOP33; zDsT>57Ue>qAUTj*;e}LJ9N!m>=V?o$Tt2Zo#syC*(Qsx?K7S6Ti{8l34)OZL!8q4P z|BX&)o$BL{z?8(51}?+|`UpXZNfM_rz4$dWwfQ|U$YfD5yh(Mk>#FJ_b9Zg-f+fM28lBrF|rvzD$TezWKdHpQ`pgkH&XX_ zlLeSD1YR>e#3?4XbwLS(-MN&`fiy^G4y;q`Nq0egC0gc;9=+9dQNgurFYoBW8`JhK zq&MWi7!BT8cFMoo6;(DAas9#0uFI;U`x>;WIhZRO=7k_`b78-cjmv!&M_E5z4*1(_ z!{9w~I%6VNy15RjCL}u!+4=azdn0_}QV$n4blJJ;ZBVVg9hlblAz3YhwLddl2kM{& z&^U$5=5jVC?sUQBOStGMbl*8&Uwa!*8;*G2f0qkUwM5G#VT*n)+;2-*W~L2Alg$(P z*X!Y;XATIiv%JSB?5590w(*H6gIowP|34&r;?W^NAwqI^{3u(ZdW)#M$JI?Y0FJD2 z41TMC{UdFd>oG;Hb^_rez0u;z11_A#W%pV>B&KS3P@`*SAu%T&s@1%p9!t#GQ7-&J z4M|N7KEGFLs2DQ#KL)=z%8Tp%@j)LUeL~NvV7MmB8!CRE5S+i<@yXr|9mRVv4sYV% zMstl#`Cf?SAz z3&E`b!2;6Spis0x0vd+cNEaks)`>|PEG>573?h35Eewb_(SMn%ybej-(*qMLQcGO7Dq=GK zJRiiwqs)asTGBaj3*OTttPFZia!lfnG8aOvAcs1+wyRu`ymE9zi0JfeaDvj0p?NI# z_`Q+(pQs(TD!5S?3hU%)t6UMhaJ9=RMz3+<==Kld*Zhb%K^NQ1x_Z2DN&Nblh)53i z?-gsGcOg8Iy%TyPHIDgcqU8qHDAUS8Zuy{}p7yrpsT*Agk4)~yV);heAW>Bt@FZ{JaDL=6V&2AET{Dd4bbSf4_m$-$fA`Tg7otYlPd;tS?;#P*d5>?v z*Y`VIIC4oWJ=x{we~14n&qZjA-!)!Q7(9P;h|rf^I0;e9|HsyM2S!;m|G$@zdi{Aw zBalK3C57HeKt&*sgdS?>!U0JD0VP0!D00*wkWpGfks3lk%_Absf|aI-O2=2R0zrN4 z!0)rO&vTda`}^ni*`3+h+1c6I*>bzQQJnf}C?;E+(L1b`o(>H~p|z>(HArlERVZeA zjKcd!^IsPR#S;dF|09EboNEi{iNGH(J`MP@L`HIL`^_ zG%C(C>OKMMJ?3W!XT$qG98q;_!&=&3ABkSc8NFjz2YyqOs@iPWnXU+;G z^RPi+Bb0zsSDrEa=Dg4%AFdkUy0wN*$x!fx&?H?%aFQal(VvH6lFjIbXAw-I5h#C( z8m6`RGW1m)EVhS;>j+3Q+4dQih1Vc*Yv}M8Fqx27qQDHNZZ1O_>#hs?&p0?lYuBp3 z3f-qu7k-$uoY%7&!k1kD`~Th7p|9y+(Ex-7z}emcCr*fdCkDBB7<&J@B}N-2DNcUS z=UEM7L~i``_q$MRw|?(YL7dCOI}Ltj{MGtaXf$PIG>p`6TQ&?5^Iv>B6c^MmAwF;F zB^0~Bsh{6$TP-Xf3MLBFjyP*Yv=}9Kdsgup<;DV^ff-nj$ZMzUJ{PP zcb2)d77s#4`kCCXxy|sp8Ch_tfyfuW-97eM>`N~h9koG_t)TL=AKY< zx=t~`Y96A0PP3a!bZMhEU`0wbi)AXolA(5L$@Az8f7UjO*^mGjO@}|NKJRQK8`%I+7%dsjqYtZZoalac-Of;L zRDJVfI@5h8nd5OmIU4y&Bl9wyrZ*2D(OP*Ev!+9EjJA$IkEV08p}EJJ`jm^sQF9no zFNgA=2;4K?+>9xbU_(2XXkM%r={1Y1mSL@JX-kj94113I0NP`9v|nrUzfB@TR4uiw z8OuXlKd)7TPMbAk9R7dGiCK+t^F}8#MkUT8%F$qX4YS9Gx?ylJv-$tfqyxp6RZT0# zq6{A}{w&R-ExgYR`>0SwF;>(@JdFlplk|5FGaN=H#@oVT6j-}uUkHVNg8vlnc+8xy zvm%^h4L&{m5yln+Z&h#eRzF&PG%!!RG`N8Bj$y6fU|%!F8GP#F%>VkCTl#TaYoBGt za+3gQXdjqM#_IYL)*d1Tn7dQA0?e%Iigkf!2buAF4TFnw%*`q1mxeYiF58Ut3r@5h zhxX@=HP;mot9ECY`F$P2UFPfvbEV9#Av-LfCzFOu@SZr%HUOw~sbaorCD#I+q~Ovo zjyGd)6*wBy4&CIy8Eh#V?@2bm;sSU?@o}2p`_JTx!k@M8M0?btg42^b7c9Fv4`+EHi@)E>?< z|EVX6={Lo;wgig8>QdS)bAZ-yju}g0A`hRAWLD~J#QMj^r_EUZ5CE-tff+MRrhDTO zHWm^W<0q*|wb0`QXofZm%$SOKiq%l8!3Lk^jb7x5^Y+4-2{;r88ZM&(cf@AJX3RQ2 zc+QN445q|2e{VCU`71i&&vu8OH&^Kp-uhYUHse4UW7=1tm)f^LpUbyk;ir7L8UIuj z5DgGaff=cK7s{x&3f=w0GgwSyn(d1{)#9at8>1i@fukkAV8*&VXXM+xSStIsLd3=E z&Cls1`7C1+nK7|pOui=P_g&_Cbat^Cr;UEej2SdT;+nyY%-Cp#>%wtfCP{0E3k@Ia zGUFDSjg1t!8M|+@=!=Y#e*p|L_}EL0obqy`4@%AN=wPgzc)`Jx|579T$3RTP{=3!F z7<@b%ih-qOCdvB)&>Ov2%S(+^Ep(^(f+VRyM21%KeUNACp_%M^%{bc2*}am;eHjLJ z*?vPm__9Fy_K-PTYk$DJN#~Gn2>hwijGYH_g}+Vld7G>)_(0aJsJ@HJ{fZ zo~G5#9yfojCpzxn@Z7m~%~tK^Ni#NrBwLrDNXU-cxZRjP{P?y<+5%kz`gNl;tU+lX zyl4L9-(?WWK>t{VIr={zm@{<2^M;k>b8}e9KDY(ED7f}xGkhp6*3&0M^&;to+m5zWJ((2V{!n><6c;T55r}o6JV%TOxk+0-u z7=hGcwT`y%H}e%8ApV9*5qHc{+KNBS{d9!~Lv_gUx4D)U@{hSl#{_F|bRI%;j@&n6 z8fl2iPNQGNe*0>ZB~)AWP>jXC5DgHV;^V}tPRu^?eu8nXu4Tb&gA<{_b}DRdacFx2 zEpN(1ZEmmyCxRHR^NuENj}7cGYgH_*XjsR6TE#KaUqda1;echp6AL;Rs@%2-&Xrg! zaHyD!XSDFpaY_;ic8k#wc!76rdkfxT5Ol_<7Hq$)#i$E9PA%JMG5QwY^Hv>effFUb zSKBtRYv9MQd&1~yd0`gA0R4Zekp2do_Tv#2EF>^{Z1y}g)Xqj(^d>5qBE{pR)FY7d z(@$VS=C^1I9A?hP+rQ`m@Dn-CXDh%NW?vjPR3wrzOEA&zSKnfoZ9bv{V~piP#`IcA zW}}Q$J5{ud#fgTl!q;hRfpa2@fK?}0^*|{}fvA-ySm4RY62(88_cpU&^7((!am9KI zi(!no#fsab_ntlOw9tZcSU+x->{B(-x$%06z_E2`5~ww8X~>0mO&xDa`fJ>ScxH3_Y$gBNa6(VzNQZs@tWpQBN9u(eZ@ zaP9NH7LS)8jsn0v;mSu)i_L0?_G5;pU+{l;eowW;(&$cTgg>(^P5)1i?mfuzj9!?y zZIRv^2KoLr*n;I`S;ti9@!4UhS=}vIi~3=xAr}n>z!*=AApz&Xhglp{xdpRfz8E@S zq{T3dq6sy)EV{MQu=&1GFN6PT6Ewwwmk`HW%8i1>5ff5K`?0q}iCs6}UU8CgFmz=%g49=(g_h}zY5~Wk!vc=bbuuZ$Wgr2#t}m9jER0K4Za=Kdz;4TnXrkfY=BZ1v|C3 zpY;(wvA-yCYX_Eix}&VQ$XLBy4b@I8wHSjBdjU)m5d6hpna7O&3vzUYWr1uJ4ZDOh zP4sr(z&!mK_Gs$2#)7rFamF1ahu2szw?JHI3xC$B$Uxm2oD%K&|6P7AqC)!70@*&G01J9JM6q1@l2pQ81xk+)Z;FzH;#i z3*1qWo3HKexmRthWxwSqiwBxI?^q`3B)~>=$z>;=$Q_2A?04U@%&E!Lkjt2X_x%Xt zEjZg)a1@-%M24yYA~w@eR|e1p7I~ZNq6xiu{QjiPz}WK_pPawe=JsQ%xA(tah!D{;d9Gv885j95&W|c%ZZz>Vv5CcjB#IDu;J~& zCSXTueJ=|m%!$H$X{lF*B66H(O1-aJ@ZPY9YnVx3mcStXE8W~1*gTo~wPmZG$ej;~ zk#z1lW*U#(vS4z~=-j&)l5zuQTvETYystxeRv7n#1+x{#L>XaZeIyny65qDKdGnSQ zbk7o@^|@==Arq_ai2;(q%xB0imhWX8Rga~p>j`Ep>3_mXOAf@<@8;hv*cTFUVJ)?( ze;Lx$AWb;sjLCw$dS7@y9OrHHKOb81bq>Y3M$PSSE!Oe*?%%=RIHR=m04qFU4-o>9 zU>fxemffO*tXNHC2n&hP>x5WgFE|kjfyOmkajIZmZLCJPt=1W|GRjzph_P9r5s2%? zVw~Ly?l{iJCl-vd;-qV8(^}d~PAfXD#1t>SbW*LD$Vp6b8`$G<*2Z+^kQ%Mc3A27H zA>y)i>Xi=?C!(zJxLplO!*2_I7$Lak%zU<>GRoReFLu>x9HqV;ZH1T1a2}xNw*>LL z@8IU;z6u9o)L1w~Q)8@eOBz~QoE0ar8J*|cWlzW=@vqt+aI|hqeJkc^4CYQ;&>z&U zH^9B#-?qV+aG{|Us}-^^@gBv2##X#NEaKYP1S<}ZGYDs)@%Pi_)-Z!Faq$dL8&grT zwHEEajTsg;`Z0HAbaoocAGJ2t0RFE*UU-103y$71638cV_L6Q*^*^ZnueB93FNU&u zeA(7uhEU5y%CCk)h`*^hwMRNwG4cycakf&c*U9=o&&Vem>!qXY;a#loqnR3CCdB+! zq*?>Dr@C3M>JZ_CYq@Dw_yN9{+N(W0f)n-8P#+u<7DyUw7fvBFK2A*Q&A+m9(`btM z63ji;+lmP#g9SGlxG~7{6d`}2Y$3el@+PKbt|RaWpX+BdD0!qucRMxJ{}{I|(+c07 zN%Ba6Rtz*a7LzrhBif09RyffTX@xbMit1YNnd^!erBmqE>7LskW86Q!F z7#kx!keW=hs#@FOR@iru3op}I;W#k?cE%!dtxdEMIaat2oM==lfnwJ;wQEpOOt2W@ z$h9U@(LXp_`|!o4f!c!cR+vRk9u1;^CFVH)tpLhv=!a+-Ld)R1{X}bBDmsBfAbdrh z;coxO!kK*FjFJC+ZC94ibsC-SfhV`10&&$BMqG5OERyH;2mXp!@+m3kt) z%;prg0RNmBITrtyX|&MO=uj!V993k64$J zgnDbNFzOuVjr`YExqEMWZl@qcH>V9M{$o z>uaXj+EB7C^CRmJY`bRp**j3?2J3Vhl#TrpF;>%!4c1fi&0n_Mwcj5|pe~z0qUvv3 zL)yIw>5H1`o3(Uxv-L^JZibE8*;}l2P2v;(_Aj-<%jM6QtyY)*`O-E|YS<3X=bD$T zPwNQLyR3^)tCAp{qtHFpg%o=*Nav`04@!O|rAEo2^y6Nui?+2y@lWrw4)-%{qyC?U zsM@#tt#Css8sHAN=7$pK?g4QBQ6po}8Bu9XF^RaMZ9ZsSAwPwq7@(!SB3NM1r>|Nk z=%2l-tnmLh^(W1`TK`;m*otACQ)7=<|1!~vqZr_p9>oCH`)#AFddI9yO(L#n*~hH~ z`sX(%tg}rtH6$dDK6uMIi;B!RamHdF^R~6hv`~w9$C~R$Z}_1C=U$1U+V7zPd1ixX z(R)?}n*nBwn$50S>uM+7w|0|p&GDgim=4OhWsTNKKC<>TQSN4_!oXMS)2!1VRP-`b zfgQ5zrv)LzbwaUc1tE@uP^`Af(Zao;wdaVI%xD3YTm*Bv4;1xj$pSUsk zs&$0?#J`lSaoTIw1Umv$bwlJnR*XMZe16k9g(@qI|5Qx)N@Pb|uhNeH3Pw22RZ_nZ zG(=oOm7XxsXS3j}4zH?DL%*~3Dsf{#uKdp0$b>JQg8vVoz)>bJ^G6WiD2wFFpR8Rt zsx`S|onoTlZR~k;;vd+|F#{3;DXiK$m{#H~TPg5W)q*?3b=qg{3GO(~#Jm0?xZ^le z-|?#uxRPiH95+h@taWLzwD>p3>+eKJ{_byrBtCV?C;uTxa-4;>=|}q@SkSLbM~nwk|TR1&10St;lTq%|t)Pi(7GU1;g4u zUT;cvo2?hUQy;hD6xeL>Ch_Ui_Suk?m8+oJ!ecBXRj&`v(q||00)%{a+fn7)HQ%Q5AAGm1rO}`el#@NEUh(W4Tq7D8t ze;!D(ZO}hQq}T@NpT}F;rt6>GTHF57Kl`?|Vg6hZ1LYAGer=04lj&xA6mlibu=4#n zfP+Z`z}c}k>(IuI0A>yZXF;8iUdPW+yDpt=;|Om6H>9^ZqkU&+^SanDmqH32QSD~S z)j$7EwZTqu>gMjYQvI{vBet#j=fg*BD-DF6wx#-KyI!_J{qt0BTYLS}mTvo5|8({f zqGYYwgviU^l01j`sb@THjHeHkUCaq)6$ni^VU9bye$nG4@&30!a)$G^wxNr ziW9?MVFT&g2{sIujjv)LIWfuh1m%2X@SpyKO|xwB|IdG1FPi`JpHb^F)}HNBPisC| zNCsGn_S_WPX!%KJXQ7`xaM@sM88m&G5E_5po^H$6KlAcz6ZOwq`L?n8=dhVJ410_V zGRXF~1E!*Uwk@B|r5dIpZH~%1pENdG|ZSX1>p~Y5V z6Zx~vcA=I0S+T?OnXuE=Sx=q4%l5tgnZL)@QGU|VS8NvTy}hT1thYdIN3=EKnJv@Bz| zn|s(6foln}aBj5h4N-{rBq(067XPMb%hR2p>3<)!%_-?;DEj(iHjSR{BAWZS?I}M1 z6z%JiP*wgK@wRQK{CejdK`{R|2y8e7^OSZ614Z0>wpchU|3jYs?~9(upFezHdr|*f z_mK_L1Ekj0TAvo$cJn2ecw8jhkz&r;M$?-cVB*Wp!pM!*vd@XSA;qbkKQCm+pS?cy zd>+3bMv=}}F&5b0u1m)*qVlV8b%N~H%|5p^H;H&{ZORv-QR`S?=~um7hh|;^VsUHT z($lp|wkp$3ZT)3oJ-4RgzZd3r+R;Z>fmE1d{NtkiHCwnz#NoGG7egR_-nt=d41dn} zN;K#KE8LH)uQ3EVRHGGceJ!#gu4uMfw&D8cyl-tI_0R9V6Rpe$<9`qu!k^VY3Z|bs zWzD1Ow{2tT!3W0BG~te|j!DE7t@y5JM*g(k6ZTl9{_IWtRhT|bec^w$g(hmy!5CEv zf45DfppF<-g8zU7_Ty$18x- zBO^_&WiO(q8ycgcCBS~lbdc8EwdSs^em|bZ1=@S9t#!E}oe8v8nGR~t1=;@yp#J|r zGCx`EPtoazhGdr7?46+14+PmtXGiuv0yfE(1VRk5z_{4i5 zwp!Z!2>b6QIyD0P6~ATev^My|W@N2n??rn?qUKN6v7D0=i?XY$H*|eS=bHs0w zM4hbGP81Vs&!-QPfqy90-pnLEan3c)j?JL1v(ag;)wfT=EKiq`Ho1WvCLM7_Ti(!) zL&uKajnOpuz}c`>=+%;7M4p*rNy12H8 zAkwv11dq6;i=c_CTm*@(r$i9sD$EmMuxq^t9Ih%6^mDmI(95+!1Qu6;2$s9nh@h_P zun6k8CW;`{HCqHG*D4vjCWF^S5ab#uW7|aF=UOI$U{{U^{9OwrY*wKNYq=)K;8hU> zxW>y^z6{35#04_8Tn77OuvWsJm$7jo2z0$D0+Z_v5%{|%%h)av1i7A&u@N$u;a`YU zo9h`FtrUU3Yp)0bT+>A0=MpX^1q>PdbSR^LbK^c2V1VOHqBJg)D5`mv>L_46r5p&G4ssU2V}eA-+-TTnAd4{xjCKguWST z?_FQW3u$3pMVb)TsC5ah$Zn?pxa#0%qH8}cwf)l;hY@GSIQx3;BE_yv@bXs!Pjr}K z*A|~xnNMt+Pi%)zY^P6bw@+-ZPpsUCiS{UVRTxo@RrAN$10;!G@G(W8r9+q|(tM0a?ji0$-= z?e>Z7^@)}H#9nGBix8c^*tO9ow%I3ES|e6i?Alr*TI|~H6MNYww#z5B$0w#Wlf?_8 zQS3VG6FcG)J6bbV=sI3A>N@EYd)p`Wu21ZIvMg{07x<}9>@%O(=RPsfS%j*KzEkWf zT+>-bh0!T?t@Vkm_lc2D>?NPrMxWSbpIE6+Y^zUfd!bMCWuMqCpV%IsnCRZ37NWNo zbN3c8(cO!=pL=5`(j=y^j!J&L>viC)Us>*4QVO;1g@+6KjFkFd-;ee3B0^#V6LvC)UO% z*3Ku^!H8*tC)AneND~ZCY3IjN>s=1)b@E^y%AhV;a9K@zgVpwRLG!H)mZsum>-t;D+}A zEw$9q*Jdi#R_u4wt!2uUw5}b(jmXvr{008ggN~~<(|qmV3CEov(^ReOeTRRLsg%*Q z<7XZ3L=uF@!r4M7>;VGdEg_J@KYL4v z32zC3@Rkq=dw@WAO982xkeg zJsixQy~58$Uj`{X*qw2+!|!Hy-_72>o1J|(`}%H|aP{5n>ATs{ce9`GW;fr>UcQ^1 zd^h{}Zg%nA?BToF!FRKN?{?)eo%Q@%#lLPLF*m#RZuacm?AW{6uXnRs?`E&w&1&jq zEp@Y!x>-lvtfFq#P&X^6oAuMp>gi@z-p$JCX5DnNYPwl7-B3&@ftwZ6&3fr}iQ(AI zO6g{ubhApjStH%7kZ#sTH>;zYwb9MW=w`>=&8p~TO?0y&x>*n1?6bSsWp}d@x`o4D zh{A*lx>*C=tblITKR2tNo3+o)%I9X?bF=EXS@Ybicy87^H(O;lYn_{w&doaKW|eab zjYBCy-`uQjZq~N`Zq_z8E1R2j&CROjW=(UmqPbbm+^lA9)-pFMnVWUY%_`<*ciipT zLz6?5zNSO;TBy8z)` zKFuCsa~&LE`cDF@r>k2Zy8Z`HL#Eqn2O9tyWl{RbjF0vq=QuTj-nA%pl<}EGNkI^3 zRXQL@MIh0#m`oI<=i04Q8DI(sS?3{k$f|S$GM)esHRxtj9+7!Q_Mt`3;b9Nk|L_1a zS@FpeQ3r*Jc0F|qO=9zKHw6tx)0q<0fAFZOtH8k zkSn}hRT6=8UR7Els8w6(h@e|-B?H0A+DaeE*;c_>5~X!EVO(ph1Ob>7ru0Wp6s8Q3 zID2VqJ>aZNHJPcnz>W)h!<8Tj+OLB;Hx9FTT1co&r393REA>F@!*FFFf|v*;3qhU? zPDCif5sQvAYVlSdDsHGGQbwd=rpib~m6dx}uUu}7f;Un<$?x}}vO)+WB}(ZenfZvu z)>Yb3UbZQeDx;KOnf;88S5!wypa)Sb8)qG*zl2`!LUk&i3(i618GC3+v|Zl;*jrZ_Y&uj@PZ=T7>T$LA*HZ={ zEruigW4Iy8VmQ}NF-kv4+LTT$lR)}vJhUioi9MJ;Dm3AOkV}?TP!5o4QO2`j`0spuB~T*7)<7s(ZwjOR^_3tAs-I3K1w39{ zWD2KbGBqY!0|VA5ono5;7P7{k>SI6>P_beZcr^kA9@uD#qtl*D&C@A)6=09QVDC!F z4GmgJ>9Siaj7FAvWu{1PMV2*WUB1##=`E|h<<0?m{x>BVK|5R9#_m;-I0yaL<|ygK9tt*;Stg z>@6Emz^I7q7RqR1bh*9~l=hm*>BC26Iu#y-aE>=onn)G~{EPVjicL^zOW5FaX)(~L z!s%GUdaB*0`(}HyCPQ7$B`Ce5{6^FHR*>KE4R(hQ!(-`6l1vYwvZmZ^%9|QW{e+iV z1SK_7A|)-Cq*c1f?x>+P)4|y!XvTqNN@o=PV>2aPvOEhF)O#J&>0?MHues7dlA0q) zZT`gM@HYOn=G?~;TPT?zw4eoB-49zRJrQ#zazD*UR0c>2%cWQ|Zla|gEaKkwAkip# z4V1hLvb`;On`1i;Rn+Wl>(Zt9u1r!IgY@S~%Hs%PlZ^pqv#tu~cG$ydf3ne#Wl|Nh zUbg$H;&xr3MlBD+P5miKpk#0-ooxXLXYRCHyj9$i!unmE!bYWgOQolj)gise)ZHj@ z6ndnj@tQ31_-?yO)vXP6d_CP`NyFD4@T=z~U)YLe_Hiqv4{8+Ank$ym+8B@CtI_u< z*6fG>)q9A3m`*7XM(1zdMrjEGquLnV@SLM)*b0Sx@Q}QL|?B;j5A1RJWaB`>%WZghGEs``NrzbG5_#{t)eNr#yn-UOU6E z{^)ILg^HW`)uL_{t{__N27-a_N6oTppwxY zkt5|bJO2LNk&B7xWDM{YnP>F#Anfj>)Is4pI&sgs(MjowSWIUQMk0_(5-oGQ+F6MN z_;hFGQJEf3i&DX2a$o!$>f`4-;xv@NqLBbD>!L)+EKOu;Tpy(7=RlSxGW=?E(A!;D zdsDj_oiIh>mv>d#py-=jx&NkgQ~FDC9VtFd!4r96T@N>Y-RAWQ>FefdEpY(#Lx!k4uzE9%_-)@e!q-Or0WAQy)XS zK0I!(>r=^TG&Tcj{@}PBcZ!{`htTaujDC?P^VuI&T1i4PJ>(wR@M%-@6FM)?&I1o?{jP5(ZI zOkb63xZnHNfUimX`+bx|N&5|%@Ztb4G(262k*P;zDmq9QJ^j8tl1`)>C7zHV7Dmcp z=;DKPC0youTY}JYlfcaAzJ?Y4K&GQmT+VZ}rjl0oRUVOf&wBEPQR;_w#oKrb`Wfx; znW$8A>ie#rLdW{C0dizWcR0f+>zbqkS+$geZ^{Hnytz#H+LM5%Y|hrSxeGIml75gl zT*>*L`i1-G^lbrbM#Z1`;ck#DLoU@a%i}_jWvA`PPi+CJ2Ns{wrU zOwAsW(O*fIEdL{Mj&uj@bJzW949r*ivmr?wzytHb0qkvjJV42i8O?NF@B^mc=nPPT zDDekBr&qMo1}c3eqEjNWUF~+KMiZ3`GSo6cqOj_|alWSNt{h}AT2JB#J4G3v*lSE- z>kT$qsDZ?}(GNH!gL$MlIM}d!O(oDaL}?}&YatVuu>(Vtfc0bi%~Wp~H-6C&Hm#?J z7{#}h$gIp|7wi$Z57B6z4iW^DifbBz{iEoB2h>@Dm}!85s5I0+(5H>M(amfq-id6? z_}_dlEZBDr+Fj=7?s+^LBjnNBVb&mhv4V=TSwpX68@h!_xM&kD?&!sTjV}Ep5LP*i zY@gd}_((^G@hD{(uB4%J^&8H^NvRC(4L3%%9GRbm>-f@M!v?Mz!TGO_Ff8Td8hmtW z>TjjdBMo6ql^_URtlI1!X*Au88d=hk{e1_{EmFKQsUa+EL-E6QPucrb^TCBDv4Ql&Sw zz8_T{fWO#xoT5Zb9N#KudftSIK68>6YhciU-u@vzPWZ-tG$RVVsd2WyLPyg5BPeaG z;oxpT&bolv#~SNPTl>jrEn~Z!;dQJv*06T;lXD{m#tiU}WK!V$+p+8bCy!H75z8CL zEnYcJX^PmTaY{1;0pqz|9maFwxbfUjtH*PlPmE_T_~-GwFcUX{t#RfAcE46mV2AKy z8JH(3ouyblN43mgy`;e3Nrm5FJz&8^LmMv9`3Xv6s+?%7lw5_DighGf02%x;QK=1v zf+s26Wsm)@L@&ODMX~vljHRhtab$3NCv zV%BVB7I5F0t;~?P&t=G&e)EMe+Id0Z-SCHY#izS3&5&zL2j&?1vpj>G7tuhDxjguc znyZWl(UWtPagyk|4BC1c@JT_AM(gj^3iC08L?6sX9Wz}KP3g{4#w>1wS3r&E=%|P& z%6i&>ZLSGB6Id&PDxWr{on_FKk5Sacr;TOC?HO`5jKW*cv{T_~jb+}I^OUC~i+l8Z z!0JQO3k(G)&nP)38E-}Bf*j$#OEm{FsQ9cBQ8M3HojjC5SCfFBKcAIyBLEP@9T{|A zptO^P9m}ADPpf!h!2C>^wDyrAC7w2KiwN_WiY-OTFq!L0hFs_wT?m|qZScH6aan}L zgV=wOG76;}SY#{@e}nEJtT;2A(yUeh%~u=_a*!$})+3)`lePaD_Pg#s!-lunVm7=Z z7PIDWTx=Bm7u%X>it1M@&Z~#ro@I+X{aK~0Wdf%6ViCIVdG?&lv9^(k1V{T(c-;vHQQ(98$ zhNy5$jUls(OwL)R)I|aFmvJL}yo@z3cDdmb^rFgAkjz|;nr~Tdtg)tN%BAf5or+3% zOVO^Yo~vc|Rq~8XvP}Y`aVw09_otS{pvCx>?NKVlzG$qJ4WfIS43NFPBhsg*50%y8 ze5>m_YWrA~;hA)P7p4#ly-_SK*IjAI15^EFN($}Y9))K-HyLG(5fyJv- zRmxaMVfiZ7$SbRirS@r}F;b{>V=dg~z6r#ORvRl6d7?J0>D;O)M@>&;W~NwM#+vRv zQTHZ}8Y|l^ig^GlC{~6`O(>w7t3V?E<){b`CoR^nJ}g{gIO5MTQb|RvFuJmpyL{XW zhKssP@X)bjtrF}j`<0n;dGPuR#zspqV^U%ZM~IJX*9z(>bmLU5Fw3}Uvpijej;~dQ zNiH!je^Kc~j-$2gHB4asI%OCn_Tf5ZB7&6l%6O@tFK1HL9GH!Vs`vgbubP~J;M!@c3Dawwk1i*iuT4j%vJzi61P6RcB7GIw#8 z$XYe(9s81!Eo*wp%V~YO{b;1(TagcRB5^ls)mTc3*}#=pxWU+|`-F;$Wdpzz^^8>M z^h$2zl#RUAwtS;9N)~t7+oo7U*oghMxK555l)G;-l=h~OOBYJ&?5Huj{b>_B7Tq_q z4i;~gGpWtWF)i_X)hyCa7|ryGYoh=>b4CnWIljDQyMeTr0vE)+8~Sa+kx9#+u_+I#|H%ZSf|EW9z%&0 zJ)lTwH_Z}rnIzhDAS#U2PbRm>lEZ74mq0M4G73*b6h}Ecg&yC**2(d*vD4SKX5DSQ z9dkZK_-4R9$cNs+c(87ag=AzzsRr6T7BiP5xU`n)CNh#T_gv**{p&`~l09kwBE*?({ zsIibTeK(IpM|UfuQF`4y$|%{}M^c<1u@?);`Mm>bDE>!#I79Samd>=jhWkGmWeE3w z)fW7eiG0<2*{gpjF|+m=uHFo?%N?DNQF|~MO zU?3c`GsV23(sIAy-7QA5imm?Q7r;o|R0zFtX;i4)Yiz~-?-CkQ28Cs?twOPix>xXE zoL6BC1*>Jd0SE60xT8W!4j8@Qg)EAX1oh0-`00E=sgLZV4;Y>M#VpTItWw-7wQAw@ z2I&5c14h5tn1!uf;pb`RppFYTQ&|?Rc$7G9F(#bfT?=yZ-F%BPwiaUWtp2-!CIj`nA~JyxZSF9k?OrQptI$+_Y2*SI;pdQEvu z0zO9v6Q^Ey=P2trh`~`7;9KY=9c5*e;rn0JQ{YF!fgbO$)EJZeHTG9CG}g^6nj&^# zFKO)gN59USW}{!{HH%HJvy5-PZdCgZootW8N-N3T-+BrT&@`1P50J7_twWa&g4MJq z;4a@eY^-0H`cwStN<*2Pb2K23y1rqwbgllfo;hzQ%_OCu{&aphD534ew(I#flpYdb z)lrjd2Ye>c zn^^IgN!Q;5ZO+sbEQ-F7dQ|BsQ(E*FCkHSsIjXdlDal|=EW>V*4 zN+X<#9eWJ)=g|wtusDLXwqr_f1kuN#NAqafaSUPe=*)3=ZSyGZ1okB72~IQni(V5! z;WHhvR2^TZfo{d;(UlWurFqoiBh2D_=8@o60%^RChb8ArT})|yA_--X~A{!D)= z3&0}+f6jr*JbV`-MYT_%=Q4CDBqSW=-t!#EUh0=l;jqg*N_h`1E~BlXxZ}832H9a= z3ml(O$vr3+zc~+S&X@0G%ap0K1 z6iQj<@Ql+q41Nv{Y6Uet&pDTzSDrxZ&Ut0B%=t@yI`#@gaqSXL^;NHS#8JO1b#UwX z6>Rga{uF}?v-MklS~(q9*FQlwsGy`zl_w2}a+;;l$s*({T{($HjI)Jt=#&YbB=fr&DIyz$V=(-^~`;0MsfIJm;`D={i_y<5O zx?AQ*pz3QF1sGw}05L+>7rEO6a>^KLc^QUK)Mfz=L1 zoi;$4(Vgc5li|SDRdqAEovb&Z{@ZEVO{{q`>TF51=t`ic;@hdqR~YZM)1t57Hf*Qs zUtzhDkrxf{=pFvd@O5A-TK!F6h({pX>F9rz*%I}6U6HcBh9YgJ{I8)%+v)h%Sfpf9 z#d`g2?15Q`D|bZD^lxAmwqxmEnS|ihH|XTsDdrZ2f6lOJ0FC|?GA+7=VP!iVyakyT zQ}rzvkzyh9odf9X<1m{!-=d^qs`wT?tC+&SQ)VMr@traQ!GrH`EVY>0f3Ktj<%&#) z2hiBXXn}x;pjayV9)>QLc7Kma4MUIXt#1DTvz=UO`U4J0;IA1!z_ZV#BR^n|BbRRf z0P~$oO@73BVlEZ_h%Erldtm^jZiB}4Ob&{(PM9)lsYWWA&@s9tB zzQGBdWdaUFx0VUrJP9#WS`g&fG?`Du|AX}B)6M^3DnFkRe=}(IkvZ1=hI0u_v!6`3 z@|)5^CS=J3_CM?0hf{a%Z7iXjdp^i)Oxif#K#2zTEs##V?TDlmzheuEK|?%c#L(I0 zK_0II?EKC(ZSe`xe-#H~S|ZKbKy>MwMLskGrQ40??J)IjOnMf}b5`u`2TfdLDt^e-ii zt}lwMt(z-OUNlhJ&vs`V;hye3mD2u!22G`v|6ogIDxLfXi_cTZbRTOToU5490`U}V z{(Z~=OKHJtV=<)=)Oq}mI%kZL}DrP zbFa6>%$*cn2A1H41=;h@1YuFtPql&nQa@D}!FvP6CR%;U{Q`5sIDf8dg1_1wNG^YM zFoF~QY6b#(Ewzm-^CGG&EZ3-7YU4mI=SwOLP#e+edqMT-TrH#iSG>&I1Pl*k{)|_l z>ISI6GTU|0NR25gKn;iiDV~|ibJ5ISz}_n|GX%rm7y&Bv!UuB$w2%dx-$|EKvnZ#?~Ya}jWVl`ON1ta z zc*Ux=Hf^DAt!fwkm!GSrURIh7@GZ2^rltpqzyG=VQuh!wlD@U6EhT2=AbG~Ton7rJ zQ83gv)Hbx=t~Qh?g9phDa@Vf50I|9bbrgbm4sfuA4m#8x5^XF*{V@!Y!>K+ZQzi_O ztB$vBJL=Q$nQ;~>b*h09_QW9R^fN4RMx0%DK(^4|PIU|jk5tt02u>(!D+IsDps}hx zf|yHHlO&n>gXrWo?A#qv)j9y2R@F`t@XR3b=bH%XSRUt~bLGLcsLLTW*tD2>)K+^T zSYBHl5x7{0WQC}2B>nM=qa$?x1emYne z(5$_2ksiyun2Mv+Jk#QmI_fw{qe@~ijmkP|q~zo9ppr9?;$QKinh!A9I93|$IXbYI znntT5W%lD#T3^)cfuogSL>JTTXmu>Am04FEiJ-i$I#E*nXpo$uCf8Hj$&@qR=JFhw zTuf#4)LxSO1uCwsHlgZwgCi;bYMhg9)Ha&pbFXCaZ&87;;7XjaP|gClB*X*PS-@_` zsIlP18f!@U#vnQ|167LAiFPXTNPRB{o)vOQfj5l)n(Q5C0`Nk+PKd1UeR}1`0NtsFNj1 zEJ_z=5ztfGQ2tNBp21=w4f>M!(zJDRCUSBZ3avC0G+i3uHr(k+R#k3OIUkv=`ExD#7 zbu?bOk82If;sp2PP;PXP>O|Rnn*?Uwf08ub-0D zbcr@YXQ*-0ka$|qEF^>qQ!rdIi6?c|7?v65^qih!=v+~3Lpl+IyPvzoIh~Z;BR*6Y zC?m|H8O^Z@*}J7027Yr|LU7Zmw58fxQeO<};#}J1B)qIv)+t1#&BNo(l+sEKl=WId zH`=0rF|9E6GC?=pYk>sDt!%BcMoc849|X7ShD< zyqVq$zVsYm?__I?W7Fx6))-l)QSb-z{)k;^qYgsQvaOmW3GW&#*RV?4s+|G2 z3;==_?bH+mquQw*5R|l2QziFRLL8Blurl7Wt5Qzp_5ha)%{WT;lHo91>MXpzL}zVU z(q450G3bO|fzO*cn-~jo40u~IP|^YAms6Jx;IEw4bWk%9-0YwZmXyy5#fDp*=u9xw zxtvyaMAgdaYDZW;ruBs`yu5A(1NoiQa0$B%B@suIhBU`Zyqo8RG@`6Wpo`^H-AT=s zh1`_2o77p2K>EVYXzX%2)){KX)PK;c(4-3-wsIQMMIDadU>EpH4F5$}!^||4ey$bn z61a0IK9DlI!mcyIZ-eC-mj@jTgdbYtfrjLc%tv`wjI50JkFHha9VH%~=jf(7CG4TM zifv_z-w;``ImIEdbic$~Fbd|Xd6Pdci`weNL5=) zQ8;OACK?)5X(dr=50SekrD-gc>uCnd1x?1x>h+o)Hafb#x%Acc=$_5A+0PVlBOLDfdyTF6^nBEv4=WM zl5XMUtO0FlR3HCjOf@8)JVdUte)5Q_Ak#OGpl6g*-AC1~GH-_=a_MjGqZmVkW^u58qBhZJ_SOk-&zj~;zoZEspn^B>3HwVpnB9D{)Pf4*zt z5IM{YdBhn`DL;jTQ{~3`b@Z`xJ#Fa)e{4P7@1>5E__;%*-#fQAYR432452k!A;FOS z^*v+Vditd|`qp}Sqz{JO^;FhJ?S|lbADD;r)G}S|gkV}a^Kv*H=6pTfO@|>_Pp$i^ zeGn|{t9HR%8Atl6k0bE!r)DD<*$-V%+$Z4LG=vV0#$4xG`#3w@=nEV0cR$r4VWqmN zTx=hQsbODSh0!-dwTtW-YD)yGGT<3k(a8*S>ngHmf(gJf!EP0m%iy0(^hPd7gW8LK z?VTQkOWms*;HBV&S!m=cT9bw852GA~M7E&*tNY`pUV~7Z$62hRxc)G7FlYU_kYoK( z{VH+{PzTGb9}kg+{kKM;Q5da49fr+f!e?s|K9cN1*fbD^tcto0gvv1T7ei#PFCD0M zkSUiz{2^FRoQ&rJ9yAKYyTctq>l${gikc5Xn^ci&kop*c%0X}$nbNnkX0WRNjVx-g z+DuaWVTe2th!mB|vYj5wTtzDeGogVg`L3d} zp@ygfhROv$N46R-YZN?G&hyi=)y6W#JXD_b1wVNhI zAJ@Qhj-`ro)V5<{D7FiRt7hQM8?FwM)Edx9@Ir;% z8-xlp3pqxpiUc(#$1opI&Is1vyb%}$n3WcKb*_z28-S|cNS1xik(m85ye%pxyr(6z zL+exN)1e`BV2fb8M+UZ>sH67pe?SA;-2Cd%>u|74cDxS z_Kn7%Syht59kXi=tWOngJVkGU1&NCVT?IpVN*3;H7)~c9z;&JWM}u%|4q)qt;R}b#ofj{{ z=06(5>z2?>H^!?&0~zsIsvHgGbMl;U+uy=C;ii=n;Mp^985&0X_k8aJEdB6n@(ZV9 zDTZMysdT2=%<{x|kA}Kw;Y9RchOQk-{cm7+Jof}ljraNZqf;@+xhZxMCI*c6(oj#o z*70I3cso1eI(CTMba@i|493GU7)s+;;*C!4ro1PN;$HR^mx_Fj$?5=^Zy(*5gnax` zd>!%Dd(m{vCfxMqWVF1S{+z7#l8n4MR4!bMo`Mmci`2YI)KQ>L!KlH2qeI1>QY_)^ z>Ig408(bI&-Bj&TpO9#$hVo)-)veGjbYq^=O2?)`Y29>csyYKfhiPgNg2U4=pK(*Y z>6qQP>G|pERGIq=bUbms#*wQw1)x(dW@c_G$yKLI_|2hYdJ^!|neeqU9)xzJlxa+U zexABS*8N-hXsX&u0OM&yJ{C-w`yYnNg`BwoX3t8en~vvWlJ2JX8R{$q>u0DdB=&FK zVuk~-VI~GUH+?qK5d1^0;1z!Qy!d(C*(7Qz^ZR9c+n3>Z8r`DLOPQU3Y$`*`IwyM$ z5_58JHeH?xrAv7dix8Y*&aRT%EvyJ51 z*>vwJR!1?aDDs8$g|k^fpP#KxL_KfM#(?jpK6BJ@2=>pxFy*H2=Wt(4nTr)LH?5ir zE5;1A$mSV#$x~_!(qo^(Op()DWz*4dnA`Jf^ai@P04BMBLKb3R zD4>1|vAkSBTNlEh7f|&=xIP8ctq?<2fvC%zZ1E?UNNU=lk(G`YfMz`B`-Ug6e1C;T2H#=UB4E&q1|0%j?;40PeRA zS@1%5IK?hO`!eiEwj9+~uQyD_6fMEbp@6g{7{MTyCGe{XDCv2%2Z9+0WcJe_ zEqu~%UNuLQ;7vDgRqsE~jh?a;tNUEi#cW#mkyLGB*Bw0hm3*0~6gLL}tkHBvQdj zBLhy{3u4o~FzYG<7A9eHys*+$@U{x*i&Yo{3P@dT$TfbLSPzM$EiXVeS%;j7J|b;6 zO#1R?SHquTHkm z2H^WOYDWYOUVy2F(!GF5Hka}k(8Mvca~rU3?(l_jTgSC&vEJZ+)G$wn zNkopL>(vpmgz<)?UIfQ@z*(4+yb^4earsk*iJ>BrDxQOs6OTFL<$KL`!m=GBOdBTq zeB)!zL|QnD`+$qEn!wPRI&^18JPXWEEaPovE7@MeSjY&oYs!le_?_k)55iMkzI6(C zq&Y|*%b7%hw*q=oFVuzLEmb_%>>0HRXv9nK1Ud7w!^pG@hBxyqr{^z71?1QOpPu2% zY8EfvW-jSw3G&gjmEIb(mU)W*okzUYY=c-cH?oD>vXL9@&PGGXn}&I8qi$wPDUZ~a zBnl)vq-^|^1h#S$rojc&b+cjbck6oje5WR!6;tMXAD!5yM$`QFo#q-fzrC5u?z#n= za|Kke1xv+@t?6?3X^YwffZC;MiUb@TMn{)G_cnj%ov#+qf>Oisygf|rgePvm7+&;| zv$@xx#FrV$_rWl^y7TAoCT3b)W;FiC!ziVvTASXR3!OMt#-qu5Wum*6Y*l-MjXqn| zGz81HVuO&`yiCPg;aF#!!PBk}w;FV=4fB{uJTW~NZ^nwJjlGPdZ!@~n*SfTJZsT5j zWE(awVY9b!F)7=P;ka6t20ven2Z%lULIrekyP75?^P9KSMl$73Z%PE=rD4y4egU>{ zu<%qsRS5VFQkVa5xqJBc4z-R<2^>yEKVzT?-HFM*<5R3RX1$CWiW^H^A-M8H91?xv zQ%smPBRPStw)z%w%{~MZ~~44<8@(KYz$ZuC(9=6Qlmg};V#Tr*U*Vw(7`oi-Hjo34L!CS z?$H`@?}l!#p)Yo$`PPtgk3qeipx#hC^xH(z>^NNRjwVn-n9-4#%`T8gUsV0?J=kI8 zl+@w!8b7@D+YUq*>}A?jd$HQGhW^=d2njcWatXR}Y4DbC1sEYA z7YR`WF(4|3!{q`ciW~}x$}RE$LBJ2!3l&z~MY(s?)m^z(-9-fbe$_SeNcjHy{+X)z zRdscBzpJ}nzp7nyPQbucJm+@N$gN7YdMh4xyXc#(=*(SY+=g-yx@8-xjZkzOUJys< z;x-OO7S>v0yM@DGDn|PEd{dZzg!w$@r74mKj8MnhcM3DD~#UArJ@R(OR z9}S}p2Qh_PeGbd|cWCBJ*c_qZd8DLAhN%UNr9WV6T?o4wSC(_KkFA0|uZ58086 z7U^NrXmpQod}pN6_}ehLxF0VIjW=Zac^eOmf3y>W*a+qA!s!^Hnq8O>DAj+&oISM* zJsct5?zrIln4rZuQz2dGmx-ZLJKXvr^yzLq5LDUoF_oTg;iAG3cuUzn@fM!hN`5KU z$l5zH^*!_Gx;sd{CEP^KwmYMexcRFK6J?e)GK`Hy?Q>tFmzIp)f zA(gcvdTbwjLE_Xb`t+bW5?kKE4Jkt3y@PW(Lhb%f{KV@~Dv#G6cAK+k%m2ZRNLlEq zYQQ=na-vf1L3O6IJ%|Om2+cScFMDfDiF2J2a-Hg%9F>UyXc7S0lo zbTB?o;1|nW^rPrCKaaeNwK=76XQ}MG$@?=lyeQcb}u$gq|b<)2!la6j8rA4R!JK{D8IV9v?LQ+17SMIvIY0I}YF~A2U*i5?jI%&IR z(nC$8Gy@f27urf8dxU%?jLNYKfXNhEA!Ij` z8afJ6s^00A-rLmsdDjf67qFw6N!MK`o!m^irHPbEj-Z~UR4pXRWCy(_V4tO8R0m zY4_`-TboG-H<42N&s06P3#k+`Psn-@soZjZ)0ThO!~mb|fo9S#uag!xlm5^|O5V>= z`E%4u$Z#Q3g**#Vs%DGhn;Ga>t+!lBA896yTqj-KOuDFvl#E}Xax5we87!ni$Q%%< z{PhQ#w*0G_=9TYlCOvzd^iVUYvG!WoWq(z5=P_AKHwhUgWC}>BnmDx?*0k>GYvq-+ zQ#0u!*GX?`CVirblrBg;t^S6}cTu5`fkGyLl&TrcoMr~Ty=Fj3mo$_9e4TW4GwG#k zQVeUko(TOW#C??iX+4f&WQ=rHPk)J>KHF&bmzdOSqo2RTmWMj(`4!%**3q1=u$J%$ z{pBmHd`u<(F_f4}^~W%3UqXLAhB?tD3LM8q#7#8oxH*!<&&DYB9G$@8N$LrV-SO?x z3G?_Qekw*=lk23}O`kK4?{`k(^;k94okTs=wD%;2-;Yw(DU8|imBcBG!Y9(sQ|4jn zdxNNl_MXC2v;AqcZMyn2+*n2XPGh{ek}PLXW+jb1gEF&d?->kT*y*v9ioQ|XPUe3T zds!ZJ(&BG1z5e|h^`g1sx2S6_MZYzVRPXJgJ{CJE?Vsi$N&I#t+D?Fn|7jj7KpO$R z`=?q=pZPOZZhC)*nc_5>{GD16IPe`NjEgDdd%W!4MR$L%X06YEuZGkYzK2&48t^al zRRb;g7yd24_eto-H>vpFc*V7oCjJ|}u#52cKBgWE^|KMC3OTHh`AVpmC^pDsNP)mD%MBmg>>Q7LwrMrKE zBco}_PdIZ%)3-n2oe~1p{*1$L`_DK^ivJ_X2S1||rc=g$;o@{E`!B3dr>*~mbwym{ z`X7$N(^T?57IOcJWKv7n1Su4VOP)#yXloH@MZ%2a>ZPhz-eiy{Z(_AW?#jc#w)b{DlWP4Y6;sj=-ZZ-I}9VJYl5W*$fN{I zJ3~3GO0aY`Y^2WDNf4aTDMr!>oS5L3FP6r?KMGS2V}{UzP|(Na9SID)?u;Hiy7#e zhv;YqDtwh(nU+~9sZB-qdcz-{T2gTnh$Il{DL@|`=qo^f2Gqpq76ES4fdK*xWOj5#1&ulq z7Nn4Y;aqP!0opUb$;~P{2+&yvx(ILs1DyA)qPqY$=|E2b`shGk0s6;*#)?}6xs8!g zY-E4{gBjq&X%#~RDA9qT0^F?w_Xu!51N`u=ctC*RIxs?j(K=8jK;t+ai3l=*0Z!3Y zQ7%BG4pa$Hs{@k+n5+X00!(3GEZcZQfJb#;x&Sj`0It88f;_=UEth#xfH^uaSAeJv z%oku01DrUnVzB^AbYQ6f&+5Q(0aob13kqngSgj*#L}e`loQJMrodD}~;8g)O=)gt+ zw&=iC0k$*nG~0MnfSo$9OMpEBAgNfzUP1OV@;a9}AizN#cvpb;b>IU54l%%K$SOV- z;IIxH5#Vzj_(FiA4DjHl;!6e^msA{QgmdauoDh}MI&emSuXW%X0lw3L?*;fl2hIv` zfq`e)=tTj3VqiA|KMQb40ga6OBFGg+IFDb&RRR9c0Dy;16$Ws8Bhi6G0a6$k&l;%$ zWH3<5K&Ajj1|~6J62QX13I?p;8euhu5gtudI7G#*1Gxftb-*V;PzUk_DA0kh0EIfx zPJs40&_RIC3^b~Gy9jcFuF_qAn{=S30DW|zuK@jZ;1&UHV_+CJW`F>L8Q@HY6+;9l zVSvYZ6+;_j{BgIA+#@RY>%ap73}=9o&sB^NU^D}7F;FJJI0j}g5D{Pk1DqDIqFjJV z9jFqZ7Nk)nt*e+M$YfU8$YmM?n8E;$DJvck;86yaGca9%84S#4V5R_1Fu)lUE1nc! z4g;J^v0|DF}_joEsS$M#)_>1Y-fNoGgiDQz)l7@M`Oh<0roHuWnixW z`*q-e00(v8T>;)_;2AFRL4%r49v4>}5#VzM9%A4N0gf{8D!rFu z>8!@cNC?TVN=+YWN-j%0ns;9yfvT*a(CNKp;HI0pWoQ2oG04cuWGq0}l`$Zh-I@ z1B6EwApD>Q;m11&Kf^)zDGc(Mkos8mPkycfSR2*US65WeSu@SP5XZ)YHU69d7mOJ)CjT>fqm@|uuJA$&K3D&I;# z_~HlQOCE$TbP&FFLHLRVd07ZwuK33nDM+~xzWng-4IyP9jrhygAP5PG9g(f_k1t2a z_#y=1OAmxEI1s+fK==X!;mZnyFD4Magh2Sh0eM2m93gzw0OV_BMCbpXYIZwq~2*( zNh1Th0Ah6nM2IYnlJ5xpW4aIhvr-ErC9rd}zslg?bd8C0w%%&uURqQRgtId?QQ$O- zoRv`$Wkv%ubA%z-QZKK>6UR8xR1-(du!h-CpUE)PYIcrE40-GDxA;MWG1lZhldYU> ztoCu_PuuupR;n_mD&IHJkan%>;4os2&a_&jGf)hhM`mX^_&}j5C;veeFCI)pdYmCdZBjonGJCPAjJv#9cTL)Z1M$FDqR+qMYZXjxldfPqRt_oM_&% zCk!4o+IsV;zeBa_I!gY-lW!a;AK~9)m3FrSj{x(2`i`E z0AC;lKdrEK6?4eQQen-b_KUM}xJJX1)=nbm!~z%1*lo#ChH9U*wuOxqPsYzK7Y$i! za7$CRA+h7{f3svNP195HQ!J0lmS(Azls#qTOeGK@;2x47s$wf&G1xfcVXOl#R$6`H z9ykk)uCj8x(xTZ`-aasRwl!Z}BvIND%=N`vnny==<>#qt_s_QaxR>|8jiXr-j-QVX zGSpaYoQp6~8s?!R?;5_bCt%$<)LtVL2HmrQN5J#gau9BXIs zaOi_pjI_lzMgcAv}}s-SU! z)g{WKrdS=q9heY5%bnCA*uurQRlko+zmQ+qt5lxxxPBrU+4ZfnAdhx#RGM4h|ZPh++8|% zug*Q7bHjCRl+KOOxrok9(7B0m4r_~XwqlabP1d=Gb#AK8P1m^@IyXz_p3=FwIv3Ts zg*x|);&_x&u~Y}2)w$<&Zl%tx(Yduc_lnNFrgIy0Zi~*np>sQQZr5O5TU6b@M+f)m z+&en=uFk!$b06v4CpvdT=RViDzv$re$ct|I`D;e6_nXcchQ!ae1mSpXBUuO2bS_ipj5>!`Ke67j>6}C7+&bscIls>3>s*1(wFTEG z-Cv}G9dxd<&UMqd9y-@k=lbYeKb^Z(=LYE9V4b@|=k9FO*?V;Eew{1Txsf_orgP(T zZoJM_=vB=QyYl`Uy1;{b&G-k) zE0vpf545ez5-*VOaD291W-gdFRMylDLH*JkxIkqO*zl;=ZXaedaDJzf2{wmC`Idf5 zU0qGxt>u-IIf?^P4@1&HNzw*XKUkv+R6DLAMespNu)s=Z%CqrAqf--X0f#D`i8G+O zyn1|71N8fN8}hVjoy%=*K7vE%s&>}SwfW^>U!7xf#e4P0rj}+t6%Ng{@rdKxTy6lh znrDkmRIp26N6VbpaJGT&D7RU)G4pJ>o<7p9lCsGYips{0y>=MV6*RUkQZ|{pPqj!v zRW%PqMoq36RaaA^W-$9+jaOn_R@mCA1~C77)s`ESeo|N7hm(v2>^St1 zXgY?pqSeX9_)N+)+AjG~qdmluahyFAo3mcrY_n^RSK2Rk71ukgvBw6(Av%&_G~>I~ zSpLyye+F)ejj!K+(cVrkVWBOp5aqXat=))b%v@{d9C{np+IhTqWUZa&4j^_;4`qp! zM?FYC5l`ut*eGjWw)xth=Nx7zcwcnzbmX=dl}!OfP_Y3Er<+a2|3g@WXwdF z^_tEd!*WEY`V~h{c(maa$Bp7IZVXEhVg2;d>{#R5(ac>50hOSrnVrKUadU9bZ`JK-YgZ$(+I2IkRRGo4)7^|lt`f(lBdmesQqA+(*4Qk3>+{(i*ptTd z2?#uTHlbA$Px#`6r@2&kqp?-Y?Oc2=?ub25Jv4NKBZp?Zpi*=U-r(R%v37%lA3}>Z zIAUuaWlJ2fxnPH74!#jw*$_XkeKQqs$3{nN{L+!UtF!qU*}PGm6^A!EctPv(Mn~*k zgy^wr;;UV?vz5-IO%7hscwv)+pMm=}Ic@;CB>$Y79mR4C&E)eX#_uM%bm1kn5-@Lb z`~s+5?FaRlBIE_yHAY&B~0r}#0vRTTX&08Fj z%nb{UC7lv2v}%?kwj5@s8Ql`?@xngpGsx(V-QbY%dXUk^6^`2K2#C-4_-F{y9B~R9 z7Hr)bceZSqgP)GZZ4Sv>4xiV&$}6a>W2TJ*6SHH7aoH?KKH&Y^;x@5vQ_|E0{)f~w ziRoNJ;Tw+Fs$!5jyusJ<{fXHz2kn9&)lCu%u6aYNr4tI zh%7cHX@!T%MxqxutxbX&7uIZ7{RA~W!C=BkGb-}s+QYwC<3m)mIetS$K&RTooOr)w zlj(kAe6{J0nd)>~_@=sMKYmj+7sNpsJL27Lp~Vjv&8hLBCh|rjrG-b`ll#1?+TRQqN&PF(HYosJJvvAxvy4({Q|EAo!RX{gigeaCSiC#jAH zV8|D@C)?pvys2;9*a_tiMeZ)ED~gZO>Zs%xZuoUH{g|V50;^H4uN*cQdHa}S#4QQ@ zVu{XpoDP*V0~_5=R~y|eDyGtKpR*ITur5Ld5)pZ6!KFkWi;nx8-2`)z=}Mv#E3;Eu zQYJX6Ie=toY!hqVYwC>7WcB7M8ltimNjx~3O0W5yUa7S#*Xa^nBw|iYvc+@}B(%Y( z>M0I5+Zm>6BLdEWoL^-9Kxa@&4!zCUT1vX9PkvHP3I@}-&A|yzAjwTX+~!Pye&0b( zzv$1r&6z9Q`~mSg{WQNQ32XOA!7|8MjB0)xiZ#P zPe|i3(U}Kw0ct3fS?PQ+6@RxhI4$`5Zi92=Se1k$8YEwNk`?>7ohI!1E&0;fUGRJ| zedWxfjbA!bTWo4chpUtD4L|4A$QqH9m|TldH(v13nJ=AfQ0(wo7dq!jMAPNG902-$ z83};*( zsV$$%RwN1Y5m-srDMS@?$%O`i%dI`T&ftFi-E@qW1@EX7I&zXO1M!U zwUJ?Tl1=M%xBH9K1b){`lSa6G*eQNtD?BP0;kLJUsU@8{nB=71A10->#QR{n@HtMo zk`Iy+3HdRshL<#WziohQH_xMsV^I*vFnFlM260`+A#cOvcI<<5@zZzY8w`$akrJZ-x$Ut_d9akhHCAE zBRAKbP|Y@0b;)(9%nl9c@x^Z#ZL_;}&DFYg%{!f+#0uDsU-Iwl0#WXBR~}m#H9Rj5 z)NI-wY27YNInekA?8}R3}dk z{$A?j`EMHjp6}(c<8N|r&u?CpaUqI%er6Q|}mC-mj+m!Se9{v~Ht4$*K5` zpm({)VR%$~pxkq>9p4jdnc?Xo-xGAA#p{w0M=+jHp+&_+^3C*gPT>6obh^=FrBj!) zEu!oe<=($$rwfoHz`mKDWW7K*k&8A^ZMny-SswQsY^m}w)Z@|9;S-}vyZof5Uow2? zHQ(bJ8S)rd#Rsh| zE&dH@EEMl&-buB8G2&Go@-7_oc<@yOiUma;prN0k`?KEhWCNdh(Bn(sa#VZ(U5n2r z4tfG0C}yEke@#wf8!g}Uw3otmd;yZobMcr4CqGD5`!2AmGqZ)+E>&5m_GEGr^*Jg& zc#e56>A9Mns2zUSb9)+eJcm6Jj~@r@^p{3QlCsf2i~f~RA)p6GRGLw@z#8Y}Ikk=7KiYU!RtFS<~JMlB~C7?SDDPvkCZpf!lT zuPw~1{&cfZhqyS;5hDNL)g%xx1Cy7F$XBaR+8krze~6UKR^VCeT)DOhx`ca}?3 zXH4?8LuI$rd3^%7CV71TqIKT(Abab)NKv3&tn*Gw5qXDcUTdPVM#g%tRa-U9+cMe8 zKr~}Oea+o9HI?~!@tyoNEPj0N=d?rHH%CZpLwYV;j2ns_hySmNNLorLs-T%PQepZ;qW40PSHzZc$aR%(x2)u2bnTVPF6%?TpX=GL3{YL*V2hC+k8&? z_}I0>;Gs3=Qmpj*i4@*~FpEx^eI2CEPGY@7md`KEzlq9P<9nZdMiWN7$}J}?GMiH9 zF_Xy{tGgYWz$2Z8_ui^bYva+ z%7cISC~*E-Uu#it(t!$uq0V~Amn48U2GpeT3AurOTk8vp)lF;AMH}e0b?{^ZO2mJ z(*i%2JYV211aXJ`1yZRStCfE2$apO^0auRdH(tOLC=JI$Idd`OH>(im+|qqvzYjLf zg#EF8>_V$oyQJfG^&7Pj#(O|>i2t?rD}*3_3{fcc0#I5ucEcJ}`< zBa!!TM#+1Nxq}K+9xW!{Er?5es*m4jn4(?ibxhwqni40--GtQrqtRj-v;}X62M?}!+v(cZR zy}I3hV}>eS&!rtSYLGcmOFrP=n<5ofe&EkBEY;3@;NO|5q7&mGHZ(cSjYGSG-u?{7 zX$PJ9%%2DH+h=}!BCokW_s_Zye^<8+1f&EuiP_SeI8?m96?^p#^BvaJ3{fu}Y^#)qyuXl1)V8!6+Zh4-4U>al|^whNf0Y)PAd9aVUX0`6>OB2}4q zSiL9Pq1|2-*vt{mf9n&-i52J*aEQ5VIx;d1um7OcH}E&FfVs&)tte4!Wn~0iqLWLl#^W%|)mCH% zKQP5Vi{AQ48ZQFQrG=g#$JpKE2?k>oZK*^1FL;7qrUU=5ZLp0vZ)_XPmC_z6sz3+N z)p`~Ny95La($?un6j1yfBH=_XO~mIMppmQ*RvbQ5Md z2+ds*EJT6LBZ63b`7w!?Aj12Gjjo zhi8M2vZ+n0f*g$c=&GRS+5vXb=_rn{b9Hc|v}xI{U~6$Ihej?kIbuh*{jQ+@TB$s3 z*zVw7qg|Z^t@xU~wWh8LcUd)WnX46j6s&j1*X{u-`x-saYZ}7FKc{{Cb+At>M4V{# zBYb&|@=W<5ZPbs!CAp&Pr-{=s?tM;!;K8&6-i=S2o%uc$wGeZk!;fJ+%P5}R2c9$8 za3ZRIdHfHrt*2?3?)>F0mjbf~Me3>}l|^G~Y9ARjQSnfx1Ksj{PNiUqDexBVYw|1I z@)06f%e^7L-&n&mDtkV^vp8~mc|ONEee3!B)&gu=p6?fL+_YtRKBl|N^Er}l;R>aA z`-=RKh_Mj%lsQ)gH{^NOnlyQ^cRxpVNsV7wQeoa04-c(&WE={+P5ywmQFjdLwkn<)lVmrpLzTc@fzvIrCG z_ik?O{Et{^i+A`LZR3X;Z-tUGkU^{{WE3$rt7c^Iv8VDbp#Z#_-zCIRk@t29ad7B! zT|z-oY)!8%K{PP*Z`V-lz?kWXD+8~^ls|}p`xc+?s_FBKL+#>?czus42>Z*rg(QqG zCa{YOGF&QzYuqh70tzy`vBIO;h1yDMhqh5J9qty&7i(BBde-cWTLy2Y{rgRL!3DQ& zh`ZI5mCW?z0aGyMn}g0RH@n1USz#y~I|18<+%2ZHq}%&tU_s$IjP$3`jom{WdbYH? zs<^RxD2RU_cMsX=t?nU{@UdouXzQO%1ufBF>eUw(3STg%iD$Uilw@FmWt#S2kI+KB zqtD)(k!O>0Bbt8Kgh*v&(WHhNIWLO`h4|_iIw<6goia0ege=;;L7_A3R^_meA7tUM zkP4eSEW{`Am%~CEJ6l!fr`}UnUQ||DUWV6H>HruQgmUFHHL{4W(Fd{WSQV+p1{|Dj z3quwWXR;Vi@w!NrxWZ@d`S~HcO&M0=$#rGb^_6P>!ZfYzqR{S4xpcDb!3!^ZmQYvI zP&+Di^<8}-Y;apDJ)Vm2v)xMr2c_iaOtt4gEZ3?aosL z9V}j@mEFH=a@k#vRF5sH$Iqy7_!qNXNSR-ou%Bg@_Lmay`28CZw&iTEu$?~HW_E*byeZtJMWiJ*|76;z<~tK^L;Rsxv;!I3 znRvw&p}jq!4M_@BZ%5(|C2dP+g<5^R3%z{gF5Vey7Yr;xM z%C=TG$Lf^-0nyucLpVuA=!9~wUg03yy<;Hkw%TP*1?KA=wr5t=H1LI|e87hHzL{7F z*p1tT0$jAeeBNVY3RL$@CG&2WXu%RZXT)o$}%0=GtY&4 za7@;Z{~B&B7KVHl_DCu0*LytE)e;40&`boxtUYK>6`i4r{P*`~mYa s?TP9SHGUorBr@DUrbjZJTFTL|l@CGQnQ)E@Y{};;ddf^CXTr(<7hrOW%m4rY diff --git a/.doctrees/image_description.doctree b/.doctrees/image_description.doctree index 88c6d24753c64d3763986adc41b811efc2c14c9c..6d2555d47db47503917214cafaa1d4cee423a635 100644 GIT binary patch delta 16 XcmaFV%=oC8al;N~Mx)I;nKkVIJu?PD delta 16 XcmaFV%=oC8al;N~M#IfJnKkVIJuL=6 diff --git a/.doctrees/image_description/elements.doctree b/.doctrees/image_description/elements.doctree index 25a9687fdef9a4f5287e24257c3aff5739a2b4c8..d9eee318403e8dadfeace9912acf62bd1d0596dc 100644 GIT binary patch delta 36 ncmex+Nc`_1@eSXZ8I78MFt`6;W&~m;AO^8nw*O#eZM_QsKZy`C delta 36 ncmex+Nc`_1@eSXZ84a6%Ft`6;W&~m;AO^8nw*O#eZM_QsKW`8+ diff --git a/.doctrees/index.doctree b/.doctrees/index.doctree index bb5a555a1047c8da9281236e48cea0bf1979b03d..4e60f6ea5d7ac41484e8e65ac6206064a4558431 100644 GIT binary patch delta 20 ccmccif$`c0#tnk3j7F0`ut;y#Wz{SO0ACvis{jB1 delta 20 ccmccif$`c0#tnk3jE0jxut;y#Wz{SO0ACRYssI20 diff --git a/.doctrees/overview.doctree b/.doctrees/overview.doctree index 7d27b2c3237bca1b42377134f3afa0b02ea98650..5d3505d3617c7f95b790f9abca40d48717e61928 100644 GIT binary patch delta 16 YcmcaPf$`=9#tj{;j7FO~SuZ#N06c{Tm;e9( delta 16 YcmcaPf$`=9#tj{;jE0*#SuZ#N06c#NmjD0& diff --git a/.doctrees/overview/workflow.doctree b/.doctrees/overview/workflow.doctree index ead3b07a71104d7e343da3d2cca834171fe765d0..eb354e02ed093e81b53da0dd6a4d9b395a096fb9 100644 GIT binary patch delta 16 YcmX@Sh4Jtf#tp4}j7FQ=`1X1O06p>swg3PC delta 16 YcmX@Sh4Jtf#tp4}jE0-r`1X1O06pvmwEzGB diff --git a/.doctrees/plugins.doctree b/.doctrees/plugins.doctree index 629890e16bf68b56670794c02ad81095ef9ed700..167f48e4447872bbd3fff7276ee0aa7716e7c8c2 100644 GIT binary patch delta 14 VcmbO$Jy&|e1ZGB~%@dh - Overview: module code — KIWI NG 10.2.1 documentation + Overview: module code — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/app.html b/_modules/kiwi/app.html index 9da74e1f61e..90ec5fbf72e 100644 --- a/_modules/kiwi/app.html +++ b/_modules/kiwi/app.html @@ -5,14 +5,14 @@ - kiwi.app — KIWI NG 10.2.1 documentation + kiwi.app — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/archive/cpio.html b/_modules/kiwi/archive/cpio.html index abe571d1ca9..67f5d3c3536 100644 --- a/_modules/kiwi/archive/cpio.html +++ b/_modules/kiwi/archive/cpio.html @@ -5,14 +5,14 @@ - kiwi.archive.cpio — KIWI NG 10.2.1 documentation + kiwi.archive.cpio — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/archive/tar.html b/_modules/kiwi/archive/tar.html index 03fe354b01e..7183e53def1 100644 --- a/_modules/kiwi/archive/tar.html +++ b/_modules/kiwi/archive/tar.html @@ -5,14 +5,14 @@ - kiwi.archive.tar — KIWI NG 10.2.1 documentation + kiwi.archive.tar — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/boot/image.html b/_modules/kiwi/boot/image.html index 866103865e1..6f3b999e9dc 100644 --- a/_modules/kiwi/boot/image.html +++ b/_modules/kiwi/boot/image.html @@ -5,14 +5,14 @@ - kiwi.boot.image — KIWI NG 10.2.1 documentation + kiwi.boot.image — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/boot/image/base.html b/_modules/kiwi/boot/image/base.html index f8bd9223300..9f44b7d8bec 100644 --- a/_modules/kiwi/boot/image/base.html +++ b/_modules/kiwi/boot/image/base.html @@ -5,14 +5,14 @@ - kiwi.boot.image.base — KIWI NG 10.2.1 documentation + kiwi.boot.image.base — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/boot/image/builtin_kiwi.html b/_modules/kiwi/boot/image/builtin_kiwi.html index 9202ea6b56b..86da8890f3a 100644 --- a/_modules/kiwi/boot/image/builtin_kiwi.html +++ b/_modules/kiwi/boot/image/builtin_kiwi.html @@ -5,14 +5,14 @@ - kiwi.boot.image.builtin_kiwi — KIWI NG 10.2.1 documentation + kiwi.boot.image.builtin_kiwi — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/boot/image/dracut.html b/_modules/kiwi/boot/image/dracut.html index 9030501b7d1..e82c222c5eb 100644 --- a/_modules/kiwi/boot/image/dracut.html +++ b/_modules/kiwi/boot/image/dracut.html @@ -5,14 +5,14 @@ - kiwi.boot.image.dracut — KIWI NG 10.2.1 documentation + kiwi.boot.image.dracut — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/bootloader/config.html b/_modules/kiwi/bootloader/config.html index 96a032afdf2..0f411858cd7 100644 --- a/_modules/kiwi/bootloader/config.html +++ b/_modules/kiwi/bootloader/config.html @@ -5,14 +5,14 @@ - kiwi.bootloader.config — KIWI NG 10.2.1 documentation + kiwi.bootloader.config — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/bootloader/config/base.html b/_modules/kiwi/bootloader/config/base.html index c4d68069469..a4f52bc5bb7 100644 --- a/_modules/kiwi/bootloader/config/base.html +++ b/_modules/kiwi/bootloader/config/base.html @@ -5,14 +5,14 @@ - kiwi.bootloader.config.base — KIWI NG 10.2.1 documentation + kiwi.bootloader.config.base — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/bootloader/config/grub2.html b/_modules/kiwi/bootloader/config/grub2.html index c28965febef..a961f5f9dcc 100644 --- a/_modules/kiwi/bootloader/config/grub2.html +++ b/_modules/kiwi/bootloader/config/grub2.html @@ -5,14 +5,14 @@ - kiwi.bootloader.config.grub2 — KIWI NG 10.2.1 documentation + kiwi.bootloader.config.grub2 — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/bootloader/config/systemd_boot.html b/_modules/kiwi/bootloader/config/systemd_boot.html index b2dd1a8dc36..03eb38c3aaa 100644 --- a/_modules/kiwi/bootloader/config/systemd_boot.html +++ b/_modules/kiwi/bootloader/config/systemd_boot.html @@ -5,14 +5,14 @@ - kiwi.bootloader.config.systemd_boot — KIWI NG 10.2.1 documentation + kiwi.bootloader.config.systemd_boot — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/bootloader/config/zipl.html b/_modules/kiwi/bootloader/config/zipl.html index bf0cfcf4709..d78a1cc70ec 100644 --- a/_modules/kiwi/bootloader/config/zipl.html +++ b/_modules/kiwi/bootloader/config/zipl.html @@ -5,14 +5,14 @@ - kiwi.bootloader.config.zipl — KIWI NG 10.2.1 documentation + kiwi.bootloader.config.zipl — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/bootloader/install.html b/_modules/kiwi/bootloader/install.html index e1a8c0c5129..494898fad88 100644 --- a/_modules/kiwi/bootloader/install.html +++ b/_modules/kiwi/bootloader/install.html @@ -5,14 +5,14 @@ - kiwi.bootloader.install — KIWI NG 10.2.1 documentation + kiwi.bootloader.install — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/bootloader/install/base.html b/_modules/kiwi/bootloader/install/base.html index 30c2160f333..a1f261aadb7 100644 --- a/_modules/kiwi/bootloader/install/base.html +++ b/_modules/kiwi/bootloader/install/base.html @@ -5,14 +5,14 @@ - kiwi.bootloader.install.base — KIWI NG 10.2.1 documentation + kiwi.bootloader.install.base — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/bootloader/install/grub2.html b/_modules/kiwi/bootloader/install/grub2.html index 5f18f4e7e51..e04115314f1 100644 --- a/_modules/kiwi/bootloader/install/grub2.html +++ b/_modules/kiwi/bootloader/install/grub2.html @@ -5,14 +5,14 @@ - kiwi.bootloader.install.grub2 — KIWI NG 10.2.1 documentation + kiwi.bootloader.install.grub2 — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/bootloader/install/systemd_boot.html b/_modules/kiwi/bootloader/install/systemd_boot.html index 15f8a2b55f5..a07c889ed8d 100644 --- a/_modules/kiwi/bootloader/install/systemd_boot.html +++ b/_modules/kiwi/bootloader/install/systemd_boot.html @@ -5,14 +5,14 @@ - kiwi.bootloader.install.systemd_boot — KIWI NG 10.2.1 documentation + kiwi.bootloader.install.systemd_boot — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/bootloader/install/zipl.html b/_modules/kiwi/bootloader/install/zipl.html index 70ee0c5e51a..5dc67241104 100644 --- a/_modules/kiwi/bootloader/install/zipl.html +++ b/_modules/kiwi/bootloader/install/zipl.html @@ -5,14 +5,14 @@ - kiwi.bootloader.install.zipl — KIWI NG 10.2.1 documentation + kiwi.bootloader.install.zipl — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/bootloader/template/grub2.html b/_modules/kiwi/bootloader/template/grub2.html index 3d3c97e9da4..ab7e5166e8f 100644 --- a/_modules/kiwi/bootloader/template/grub2.html +++ b/_modules/kiwi/bootloader/template/grub2.html @@ -5,14 +5,14 @@ - kiwi.bootloader.template.grub2 — KIWI NG 10.2.1 documentation + kiwi.bootloader.template.grub2 — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/builder.html b/_modules/kiwi/builder.html index d1859105057..d08aacb3032 100644 --- a/_modules/kiwi/builder.html +++ b/_modules/kiwi/builder.html @@ -5,14 +5,14 @@ - kiwi.builder — KIWI NG 10.2.1 documentation + kiwi.builder — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/builder/archive.html b/_modules/kiwi/builder/archive.html index f748cec4860..7f38eaf01c2 100644 --- a/_modules/kiwi/builder/archive.html +++ b/_modules/kiwi/builder/archive.html @@ -5,14 +5,14 @@ - kiwi.builder.archive — KIWI NG 10.2.1 documentation + kiwi.builder.archive — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/builder/container.html b/_modules/kiwi/builder/container.html index 3f9dc119c78..1177c633c09 100644 --- a/_modules/kiwi/builder/container.html +++ b/_modules/kiwi/builder/container.html @@ -5,14 +5,14 @@ - kiwi.builder.container — KIWI NG 10.2.1 documentation + kiwi.builder.container — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/builder/disk.html b/_modules/kiwi/builder/disk.html index 16064e78755..00b94f24319 100644 --- a/_modules/kiwi/builder/disk.html +++ b/_modules/kiwi/builder/disk.html @@ -5,14 +5,14 @@ - kiwi.builder.disk — KIWI NG 10.2.1 documentation + kiwi.builder.disk — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/builder/filesystem.html b/_modules/kiwi/builder/filesystem.html index 313396e5cc3..7d5c84dbbaf 100644 --- a/_modules/kiwi/builder/filesystem.html +++ b/_modules/kiwi/builder/filesystem.html @@ -5,14 +5,14 @@ - kiwi.builder.filesystem — KIWI NG 10.2.1 documentation + kiwi.builder.filesystem — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/builder/install.html b/_modules/kiwi/builder/install.html index fd62a9b72ab..b9000b4be3c 100644 --- a/_modules/kiwi/builder/install.html +++ b/_modules/kiwi/builder/install.html @@ -5,14 +5,14 @@ - kiwi.builder.install — KIWI NG 10.2.1 documentation + kiwi.builder.install — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/builder/kis.html b/_modules/kiwi/builder/kis.html index 0bf5a92d79d..8eac612e1b6 100644 --- a/_modules/kiwi/builder/kis.html +++ b/_modules/kiwi/builder/kis.html @@ -5,14 +5,14 @@ - kiwi.builder.kis — KIWI NG 10.2.1 documentation + kiwi.builder.kis — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/builder/live.html b/_modules/kiwi/builder/live.html index 4e7e8f309d3..acde415fe35 100644 --- a/_modules/kiwi/builder/live.html +++ b/_modules/kiwi/builder/live.html @@ -5,14 +5,14 @@ - kiwi.builder.live — KIWI NG 10.2.1 documentation + kiwi.builder.live — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/cli.html b/_modules/kiwi/cli.html index 0b0bbd44706..33c4bb28834 100644 --- a/_modules/kiwi/cli.html +++ b/_modules/kiwi/cli.html @@ -5,14 +5,14 @@ - kiwi.cli — KIWI NG 10.2.1 documentation + kiwi.cli — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/command.html b/_modules/kiwi/command.html index 606a0c6cd61..a9e3f312603 100644 --- a/_modules/kiwi/command.html +++ b/_modules/kiwi/command.html @@ -5,14 +5,14 @@ - kiwi.command — KIWI NG 10.2.1 documentation + kiwi.command — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/command_process.html b/_modules/kiwi/command_process.html index f50dcaf8586..edc5cf9df1e 100644 --- a/_modules/kiwi/command_process.html +++ b/_modules/kiwi/command_process.html @@ -5,14 +5,14 @@ - kiwi.command_process — KIWI NG 10.2.1 documentation + kiwi.command_process — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/container.html b/_modules/kiwi/container.html index ba11a380a7a..86513977d95 100644 --- a/_modules/kiwi/container.html +++ b/_modules/kiwi/container.html @@ -5,14 +5,14 @@ - kiwi.container — KIWI NG 10.2.1 documentation + kiwi.container — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/container/oci.html b/_modules/kiwi/container/oci.html index 079b54d0a7e..a7b40bfe295 100644 --- a/_modules/kiwi/container/oci.html +++ b/_modules/kiwi/container/oci.html @@ -5,14 +5,14 @@ - kiwi.container.oci — KIWI NG 10.2.1 documentation + kiwi.container.oci — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/container/setup.html b/_modules/kiwi/container/setup.html index 8d5df1d1e13..c947acf6281 100644 --- a/_modules/kiwi/container/setup.html +++ b/_modules/kiwi/container/setup.html @@ -5,14 +5,14 @@ - kiwi.container.setup — KIWI NG 10.2.1 documentation + kiwi.container.setup — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/container/setup/base.html b/_modules/kiwi/container/setup/base.html index 8abcef71177..d24f07e655f 100644 --- a/_modules/kiwi/container/setup/base.html +++ b/_modules/kiwi/container/setup/base.html @@ -5,14 +5,14 @@ - kiwi.container.setup.base — KIWI NG 10.2.1 documentation + kiwi.container.setup.base — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/container/setup/docker.html b/_modules/kiwi/container/setup/docker.html index a94eb92f329..0294ed98012 100644 --- a/_modules/kiwi/container/setup/docker.html +++ b/_modules/kiwi/container/setup/docker.html @@ -5,14 +5,14 @@ - kiwi.container.setup.docker — KIWI NG 10.2.1 documentation + kiwi.container.setup.docker — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/defaults.html b/_modules/kiwi/defaults.html index f411da54b89..54dd96e227d 100644 --- a/_modules/kiwi/defaults.html +++ b/_modules/kiwi/defaults.html @@ -5,14 +5,14 @@ - kiwi.defaults — KIWI NG 10.2.1 documentation + kiwi.defaults — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/exceptions.html b/_modules/kiwi/exceptions.html index 900ced8fac7..83c5c90ac49 100644 --- a/_modules/kiwi/exceptions.html +++ b/_modules/kiwi/exceptions.html @@ -5,14 +5,14 @@ - kiwi.exceptions — KIWI NG 10.2.1 documentation + kiwi.exceptions — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/filesystem.html b/_modules/kiwi/filesystem.html index ed110a051a1..b1a4498d901 100644 --- a/_modules/kiwi/filesystem.html +++ b/_modules/kiwi/filesystem.html @@ -5,14 +5,14 @@ - kiwi.filesystem — KIWI NG 10.2.1 documentation + kiwi.filesystem — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/filesystem/base.html b/_modules/kiwi/filesystem/base.html index e45bab1f4e8..f3039636895 100644 --- a/_modules/kiwi/filesystem/base.html +++ b/_modules/kiwi/filesystem/base.html @@ -5,14 +5,14 @@ - kiwi.filesystem.base — KIWI NG 10.2.1 documentation + kiwi.filesystem.base — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/filesystem/btrfs.html b/_modules/kiwi/filesystem/btrfs.html index ebbf1172f5a..b953c7481fa 100644 --- a/_modules/kiwi/filesystem/btrfs.html +++ b/_modules/kiwi/filesystem/btrfs.html @@ -5,14 +5,14 @@ - kiwi.filesystem.btrfs — KIWI NG 10.2.1 documentation + kiwi.filesystem.btrfs — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/filesystem/ext2.html b/_modules/kiwi/filesystem/ext2.html index 4b04a577056..59216dafe32 100644 --- a/_modules/kiwi/filesystem/ext2.html +++ b/_modules/kiwi/filesystem/ext2.html @@ -5,14 +5,14 @@ - kiwi.filesystem.ext2 — KIWI NG 10.2.1 documentation + kiwi.filesystem.ext2 — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/filesystem/ext3.html b/_modules/kiwi/filesystem/ext3.html index 99e7baf89ab..c4e3af4a2ad 100644 --- a/_modules/kiwi/filesystem/ext3.html +++ b/_modules/kiwi/filesystem/ext3.html @@ -5,14 +5,14 @@ - kiwi.filesystem.ext3 — KIWI NG 10.2.1 documentation + kiwi.filesystem.ext3 — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/filesystem/ext4.html b/_modules/kiwi/filesystem/ext4.html index b3608c8ef94..7234c136a61 100644 --- a/_modules/kiwi/filesystem/ext4.html +++ b/_modules/kiwi/filesystem/ext4.html @@ -5,14 +5,14 @@ - kiwi.filesystem.ext4 — KIWI NG 10.2.1 documentation + kiwi.filesystem.ext4 — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/filesystem/fat16.html b/_modules/kiwi/filesystem/fat16.html index 0dc7033e879..8ff75047582 100644 --- a/_modules/kiwi/filesystem/fat16.html +++ b/_modules/kiwi/filesystem/fat16.html @@ -5,14 +5,14 @@ - kiwi.filesystem.fat16 — KIWI NG 10.2.1 documentation + kiwi.filesystem.fat16 — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/filesystem/fat32.html b/_modules/kiwi/filesystem/fat32.html index 8238abfaf4f..d85053a6eb2 100644 --- a/_modules/kiwi/filesystem/fat32.html +++ b/_modules/kiwi/filesystem/fat32.html @@ -5,14 +5,14 @@ - kiwi.filesystem.fat32 — KIWI NG 10.2.1 documentation + kiwi.filesystem.fat32 — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/filesystem/isofs.html b/_modules/kiwi/filesystem/isofs.html index 2617c07ba5e..4eef1f983bd 100644 --- a/_modules/kiwi/filesystem/isofs.html +++ b/_modules/kiwi/filesystem/isofs.html @@ -5,14 +5,14 @@ - kiwi.filesystem.isofs — KIWI NG 10.2.1 documentation + kiwi.filesystem.isofs — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/filesystem/setup.html b/_modules/kiwi/filesystem/setup.html index c8948b3e564..d6528233ebe 100644 --- a/_modules/kiwi/filesystem/setup.html +++ b/_modules/kiwi/filesystem/setup.html @@ -5,14 +5,14 @@ - kiwi.filesystem.setup — KIWI NG 10.2.1 documentation + kiwi.filesystem.setup — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/filesystem/squashfs.html b/_modules/kiwi/filesystem/squashfs.html index 18274ac2da4..0fcd18088c8 100644 --- a/_modules/kiwi/filesystem/squashfs.html +++ b/_modules/kiwi/filesystem/squashfs.html @@ -5,14 +5,14 @@ - kiwi.filesystem.squashfs — KIWI NG 10.2.1 documentation + kiwi.filesystem.squashfs — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/filesystem/xfs.html b/_modules/kiwi/filesystem/xfs.html index a7b782311df..826f3cce939 100644 --- a/_modules/kiwi/filesystem/xfs.html +++ b/_modules/kiwi/filesystem/xfs.html @@ -5,14 +5,14 @@ - kiwi.filesystem.xfs — KIWI NG 10.2.1 documentation + kiwi.filesystem.xfs — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/firmware.html b/_modules/kiwi/firmware.html index fc7fd0b104d..3d6d6a842b4 100644 --- a/_modules/kiwi/firmware.html +++ b/_modules/kiwi/firmware.html @@ -5,14 +5,14 @@ - kiwi.firmware — KIWI NG 10.2.1 documentation + kiwi.firmware — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/help.html b/_modules/kiwi/help.html index 98af7ea593b..a7a50fbd707 100644 --- a/_modules/kiwi/help.html +++ b/_modules/kiwi/help.html @@ -5,14 +5,14 @@ - kiwi.help — KIWI NG 10.2.1 documentation + kiwi.help — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/iso_tools.html b/_modules/kiwi/iso_tools.html index a993d54b4f3..00594d27fb2 100644 --- a/_modules/kiwi/iso_tools.html +++ b/_modules/kiwi/iso_tools.html @@ -5,14 +5,14 @@ - kiwi.iso_tools — KIWI NG 10.2.1 documentation + kiwi.iso_tools — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/iso_tools/base.html b/_modules/kiwi/iso_tools/base.html index f840a1a1c4d..0277b165711 100644 --- a/_modules/kiwi/iso_tools/base.html +++ b/_modules/kiwi/iso_tools/base.html @@ -5,14 +5,14 @@ - kiwi.iso_tools.base — KIWI NG 10.2.1 documentation + kiwi.iso_tools.base — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/iso_tools/iso.html b/_modules/kiwi/iso_tools/iso.html index 233f28d6fe1..51973f600db 100644 --- a/_modules/kiwi/iso_tools/iso.html +++ b/_modules/kiwi/iso_tools/iso.html @@ -5,14 +5,14 @@ - kiwi.iso_tools.iso — KIWI NG 10.2.1 documentation + kiwi.iso_tools.iso — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/iso_tools/xorriso.html b/_modules/kiwi/iso_tools/xorriso.html index cf90bbb9c00..906795863dd 100644 --- a/_modules/kiwi/iso_tools/xorriso.html +++ b/_modules/kiwi/iso_tools/xorriso.html @@ -5,14 +5,14 @@ - kiwi.iso_tools.xorriso — KIWI NG 10.2.1 documentation + kiwi.iso_tools.xorriso — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/kiwi.html b/_modules/kiwi/kiwi.html index 67c41f0c08b..70d01afdb19 100644 --- a/_modules/kiwi/kiwi.html +++ b/_modules/kiwi/kiwi.html @@ -5,14 +5,14 @@ - kiwi.kiwi — KIWI NG 10.2.1 documentation + kiwi.kiwi — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/logger.html b/_modules/kiwi/logger.html index 7a0aa61cd92..dbf8ad3d245 100644 --- a/_modules/kiwi/logger.html +++ b/_modules/kiwi/logger.html @@ -5,14 +5,14 @@ - kiwi.logger — KIWI NG 10.2.1 documentation + kiwi.logger — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/logger_color_formatter.html b/_modules/kiwi/logger_color_formatter.html index 45ec174b595..bd574912ef5 100644 --- a/_modules/kiwi/logger_color_formatter.html +++ b/_modules/kiwi/logger_color_formatter.html @@ -5,14 +5,14 @@ - kiwi.logger_color_formatter — KIWI NG 10.2.1 documentation + kiwi.logger_color_formatter — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/logger_filter.html b/_modules/kiwi/logger_filter.html index cb6654afd52..6130541b113 100644 --- a/_modules/kiwi/logger_filter.html +++ b/_modules/kiwi/logger_filter.html @@ -5,14 +5,14 @@ - kiwi.logger_filter — KIWI NG 10.2.1 documentation + kiwi.logger_filter — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/mount_manager.html b/_modules/kiwi/mount_manager.html index 38facce5f65..3b0b20c68df 100644 --- a/_modules/kiwi/mount_manager.html +++ b/_modules/kiwi/mount_manager.html @@ -5,14 +5,14 @@ - kiwi.mount_manager — KIWI NG 10.2.1 documentation + kiwi.mount_manager — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/package_manager.html b/_modules/kiwi/package_manager.html index ccb591a1416..bf79e0675f7 100644 --- a/_modules/kiwi/package_manager.html +++ b/_modules/kiwi/package_manager.html @@ -5,14 +5,14 @@ - kiwi.package_manager — KIWI NG 10.2.1 documentation + kiwi.package_manager — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/package_manager/base.html b/_modules/kiwi/package_manager/base.html index f8734bb35b9..e19748f8d56 100644 --- a/_modules/kiwi/package_manager/base.html +++ b/_modules/kiwi/package_manager/base.html @@ -5,14 +5,14 @@ - kiwi.package_manager.base — KIWI NG 10.2.1 documentation + kiwi.package_manager.base — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/package_manager/dnf4.html b/_modules/kiwi/package_manager/dnf4.html index 9c1b507d2e6..bf858d5707e 100644 --- a/_modules/kiwi/package_manager/dnf4.html +++ b/_modules/kiwi/package_manager/dnf4.html @@ -5,14 +5,14 @@ - kiwi.package_manager.dnf4 — KIWI NG 10.2.1 documentation + kiwi.package_manager.dnf4 — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/package_manager/zypper.html b/_modules/kiwi/package_manager/zypper.html index 109b032ebdd..ad95c11957b 100644 --- a/_modules/kiwi/package_manager/zypper.html +++ b/_modules/kiwi/package_manager/zypper.html @@ -5,14 +5,14 @@ - kiwi.package_manager.zypper — KIWI NG 10.2.1 documentation + kiwi.package_manager.zypper — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/partitioner.html b/_modules/kiwi/partitioner.html index 659f896c2b3..e1da47fbf7e 100644 --- a/_modules/kiwi/partitioner.html +++ b/_modules/kiwi/partitioner.html @@ -5,14 +5,14 @@ - kiwi.partitioner — KIWI NG 10.2.1 documentation + kiwi.partitioner — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/partitioner/base.html b/_modules/kiwi/partitioner/base.html index f97bfcff3bd..481296429ed 100644 --- a/_modules/kiwi/partitioner/base.html +++ b/_modules/kiwi/partitioner/base.html @@ -5,14 +5,14 @@ - kiwi.partitioner.base — KIWI NG 10.2.1 documentation + kiwi.partitioner.base — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/partitioner/dasd.html b/_modules/kiwi/partitioner/dasd.html index f4198c1a0ae..89d7c9dd753 100644 --- a/_modules/kiwi/partitioner/dasd.html +++ b/_modules/kiwi/partitioner/dasd.html @@ -5,14 +5,14 @@ - kiwi.partitioner.dasd — KIWI NG 10.2.1 documentation + kiwi.partitioner.dasd — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/partitioner/gpt.html b/_modules/kiwi/partitioner/gpt.html index 056ed81978d..6c7f39c6368 100644 --- a/_modules/kiwi/partitioner/gpt.html +++ b/_modules/kiwi/partitioner/gpt.html @@ -5,14 +5,14 @@ - kiwi.partitioner.gpt — KIWI NG 10.2.1 documentation + kiwi.partitioner.gpt — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/partitioner/msdos.html b/_modules/kiwi/partitioner/msdos.html index 309a6ba92c7..ee972d20698 100644 --- a/_modules/kiwi/partitioner/msdos.html +++ b/_modules/kiwi/partitioner/msdos.html @@ -5,14 +5,14 @@ - kiwi.partitioner.msdos — KIWI NG 10.2.1 documentation + kiwi.partitioner.msdos — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/path.html b/_modules/kiwi/path.html index c912f4ea826..75f3e3ac8ca 100644 --- a/_modules/kiwi/path.html +++ b/_modules/kiwi/path.html @@ -5,14 +5,14 @@ - kiwi.path — KIWI NG 10.2.1 documentation + kiwi.path — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/privileges.html b/_modules/kiwi/privileges.html index 965657c0823..ab0447f24a0 100644 --- a/_modules/kiwi/privileges.html +++ b/_modules/kiwi/privileges.html @@ -5,14 +5,14 @@ - kiwi.privileges — KIWI NG 10.2.1 documentation + kiwi.privileges — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/repository.html b/_modules/kiwi/repository.html index 01701c17a2f..cd17b788c46 100644 --- a/_modules/kiwi/repository.html +++ b/_modules/kiwi/repository.html @@ -5,14 +5,14 @@ - kiwi.repository — KIWI NG 10.2.1 documentation + kiwi.repository — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/repository/base.html b/_modules/kiwi/repository/base.html index d14290b8b0d..b58998fdb0b 100644 --- a/_modules/kiwi/repository/base.html +++ b/_modules/kiwi/repository/base.html @@ -5,14 +5,14 @@ - kiwi.repository.base — KIWI NG 10.2.1 documentation + kiwi.repository.base — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/repository/dnf4.html b/_modules/kiwi/repository/dnf4.html index 2f2172caa4c..6bf00f1eca1 100644 --- a/_modules/kiwi/repository/dnf4.html +++ b/_modules/kiwi/repository/dnf4.html @@ -5,14 +5,14 @@ - kiwi.repository.dnf4 — KIWI NG 10.2.1 documentation + kiwi.repository.dnf4 — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/repository/template/apt.html b/_modules/kiwi/repository/template/apt.html index 7d7392f81e2..a32327f8d17 100644 --- a/_modules/kiwi/repository/template/apt.html +++ b/_modules/kiwi/repository/template/apt.html @@ -5,14 +5,14 @@ - kiwi.repository.template.apt — KIWI NG 10.2.1 documentation + kiwi.repository.template.apt — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/repository/zypper.html b/_modules/kiwi/repository/zypper.html index 2f8a1516780..11e9c8e95cf 100644 --- a/_modules/kiwi/repository/zypper.html +++ b/_modules/kiwi/repository/zypper.html @@ -5,14 +5,14 @@ - kiwi.repository.zypper — KIWI NG 10.2.1 documentation + kiwi.repository.zypper — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/runtime_checker.html b/_modules/kiwi/runtime_checker.html index 40cc0faa6e1..99e78b2971c 100644 --- a/_modules/kiwi/runtime_checker.html +++ b/_modules/kiwi/runtime_checker.html @@ -5,14 +5,14 @@ - kiwi.runtime_checker — KIWI NG 10.2.1 documentation + kiwi.runtime_checker — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/runtime_config.html b/_modules/kiwi/runtime_config.html index db8d71eb493..3218e6477bb 100644 --- a/_modules/kiwi/runtime_config.html +++ b/_modules/kiwi/runtime_config.html @@ -5,14 +5,14 @@ - kiwi.runtime_config — KIWI NG 10.2.1 documentation + kiwi.runtime_config — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/solver/repository.html b/_modules/kiwi/solver/repository.html index 8f39a098ea0..f4bb3e27587 100644 --- a/_modules/kiwi/solver/repository.html +++ b/_modules/kiwi/solver/repository.html @@ -5,14 +5,14 @@ - kiwi.solver.repository — KIWI NG 10.2.1 documentation + kiwi.solver.repository — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/solver/repository/base.html b/_modules/kiwi/solver/repository/base.html index de581bf66d3..a9ffa7259c9 100644 --- a/_modules/kiwi/solver/repository/base.html +++ b/_modules/kiwi/solver/repository/base.html @@ -5,14 +5,14 @@ - kiwi.solver.repository.base — KIWI NG 10.2.1 documentation + kiwi.solver.repository.base — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/solver/repository/rpm_dir.html b/_modules/kiwi/solver/repository/rpm_dir.html index 31a9c2f6667..47b09fde3fe 100644 --- a/_modules/kiwi/solver/repository/rpm_dir.html +++ b/_modules/kiwi/solver/repository/rpm_dir.html @@ -5,14 +5,14 @@ - kiwi.solver.repository.rpm_dir — KIWI NG 10.2.1 documentation + kiwi.solver.repository.rpm_dir — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/solver/repository/rpm_md.html b/_modules/kiwi/solver/repository/rpm_md.html index bdf5d6415b9..2e7682ac2a8 100644 --- a/_modules/kiwi/solver/repository/rpm_md.html +++ b/_modules/kiwi/solver/repository/rpm_md.html @@ -5,14 +5,14 @@ - kiwi.solver.repository.rpm_md — KIWI NG 10.2.1 documentation + kiwi.solver.repository.rpm_md — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/solver/repository/suse.html b/_modules/kiwi/solver/repository/suse.html index 38af47e4b39..49bd4f2fae9 100644 --- a/_modules/kiwi/solver/repository/suse.html +++ b/_modules/kiwi/solver/repository/suse.html @@ -5,14 +5,14 @@ - kiwi.solver.repository.suse — KIWI NG 10.2.1 documentation + kiwi.solver.repository.suse — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/solver/sat.html b/_modules/kiwi/solver/sat.html index 39693d686e7..763608ea0bf 100644 --- a/_modules/kiwi/solver/sat.html +++ b/_modules/kiwi/solver/sat.html @@ -5,14 +5,14 @@ - kiwi.solver.sat — KIWI NG 10.2.1 documentation + kiwi.solver.sat — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/storage/clone_device.html b/_modules/kiwi/storage/clone_device.html index 62304ebe0b0..80986ae02c1 100644 --- a/_modules/kiwi/storage/clone_device.html +++ b/_modules/kiwi/storage/clone_device.html @@ -5,14 +5,14 @@ - kiwi.storage.clone_device — KIWI NG 10.2.1 documentation + kiwi.storage.clone_device — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/storage/device_provider.html b/_modules/kiwi/storage/device_provider.html index 802bca15ac6..b2f6e180e2e 100644 --- a/_modules/kiwi/storage/device_provider.html +++ b/_modules/kiwi/storage/device_provider.html @@ -5,14 +5,14 @@ - kiwi.storage.device_provider — KIWI NG 10.2.1 documentation + kiwi.storage.device_provider — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/storage/disk.html b/_modules/kiwi/storage/disk.html index a318bf4a894..28ca0adf620 100644 --- a/_modules/kiwi/storage/disk.html +++ b/_modules/kiwi/storage/disk.html @@ -5,14 +5,14 @@ - kiwi.storage.disk — KIWI NG 10.2.1 documentation + kiwi.storage.disk — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/storage/loop_device.html b/_modules/kiwi/storage/loop_device.html index 9a45c135138..258c790d288 100644 --- a/_modules/kiwi/storage/loop_device.html +++ b/_modules/kiwi/storage/loop_device.html @@ -5,14 +5,14 @@ - kiwi.storage.loop_device — KIWI NG 10.2.1 documentation + kiwi.storage.loop_device — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/storage/luks_device.html b/_modules/kiwi/storage/luks_device.html index f029ae56ce3..312bc4731e9 100644 --- a/_modules/kiwi/storage/luks_device.html +++ b/_modules/kiwi/storage/luks_device.html @@ -5,14 +5,14 @@ - kiwi.storage.luks_device — KIWI NG 10.2.1 documentation + kiwi.storage.luks_device — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/storage/mapped_device.html b/_modules/kiwi/storage/mapped_device.html index 84645079ba9..55d10b305f3 100644 --- a/_modules/kiwi/storage/mapped_device.html +++ b/_modules/kiwi/storage/mapped_device.html @@ -5,14 +5,14 @@ - kiwi.storage.mapped_device — KIWI NG 10.2.1 documentation + kiwi.storage.mapped_device — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/storage/raid_device.html b/_modules/kiwi/storage/raid_device.html index 4919b3d4d15..effcd6be052 100644 --- a/_modules/kiwi/storage/raid_device.html +++ b/_modules/kiwi/storage/raid_device.html @@ -5,14 +5,14 @@ - kiwi.storage.raid_device — KIWI NG 10.2.1 documentation + kiwi.storage.raid_device — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/storage/setup.html b/_modules/kiwi/storage/setup.html index 1c05f89eae2..7072619ba6c 100644 --- a/_modules/kiwi/storage/setup.html +++ b/_modules/kiwi/storage/setup.html @@ -5,14 +5,14 @@ - kiwi.storage.setup — KIWI NG 10.2.1 documentation + kiwi.storage.setup — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/storage/subformat.html b/_modules/kiwi/storage/subformat.html index 0705bc86d64..5f8f7295eac 100644 --- a/_modules/kiwi/storage/subformat.html +++ b/_modules/kiwi/storage/subformat.html @@ -5,14 +5,14 @@ - kiwi.storage.subformat — KIWI NG 10.2.1 documentation + kiwi.storage.subformat — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/storage/subformat/base.html b/_modules/kiwi/storage/subformat/base.html index dd6c6d79ff8..96b0d55accf 100644 --- a/_modules/kiwi/storage/subformat/base.html +++ b/_modules/kiwi/storage/subformat/base.html @@ -5,14 +5,14 @@ - kiwi.storage.subformat.base — KIWI NG 10.2.1 documentation + kiwi.storage.subformat.base — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/storage/subformat/gce.html b/_modules/kiwi/storage/subformat/gce.html index 14ff30dabf1..b434c036da9 100644 --- a/_modules/kiwi/storage/subformat/gce.html +++ b/_modules/kiwi/storage/subformat/gce.html @@ -5,14 +5,14 @@ - kiwi.storage.subformat.gce — KIWI NG 10.2.1 documentation + kiwi.storage.subformat.gce — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/storage/subformat/ova.html b/_modules/kiwi/storage/subformat/ova.html index 78ac5dab67f..1789e6c3bb1 100644 --- a/_modules/kiwi/storage/subformat/ova.html +++ b/_modules/kiwi/storage/subformat/ova.html @@ -5,14 +5,14 @@ - kiwi.storage.subformat.ova — KIWI NG 10.2.1 documentation + kiwi.storage.subformat.ova — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/storage/subformat/qcow2.html b/_modules/kiwi/storage/subformat/qcow2.html index ed878f7ef06..351a522a413 100644 --- a/_modules/kiwi/storage/subformat/qcow2.html +++ b/_modules/kiwi/storage/subformat/qcow2.html @@ -5,14 +5,14 @@ - kiwi.storage.subformat.qcow2 — KIWI NG 10.2.1 documentation + kiwi.storage.subformat.qcow2 — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/storage/subformat/template/vagrant_config.html b/_modules/kiwi/storage/subformat/template/vagrant_config.html index 93dc970622c..d43edae1ac0 100644 --- a/_modules/kiwi/storage/subformat/template/vagrant_config.html +++ b/_modules/kiwi/storage/subformat/template/vagrant_config.html @@ -5,14 +5,14 @@ - kiwi.storage.subformat.template.vagrant_config — KIWI NG 10.2.1 documentation + kiwi.storage.subformat.template.vagrant_config — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/storage/subformat/template/virtualbox_ovf.html b/_modules/kiwi/storage/subformat/template/virtualbox_ovf.html index aa8af7884a4..7b0fe43e68a 100644 --- a/_modules/kiwi/storage/subformat/template/virtualbox_ovf.html +++ b/_modules/kiwi/storage/subformat/template/virtualbox_ovf.html @@ -5,14 +5,14 @@ - kiwi.storage.subformat.template.virtualbox_ovf — KIWI NG 10.2.1 documentation + kiwi.storage.subformat.template.virtualbox_ovf — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/storage/subformat/template/vmware_settings.html b/_modules/kiwi/storage/subformat/template/vmware_settings.html index 0e2ab3c998e..5068d061df7 100644 --- a/_modules/kiwi/storage/subformat/template/vmware_settings.html +++ b/_modules/kiwi/storage/subformat/template/vmware_settings.html @@ -5,14 +5,14 @@ - kiwi.storage.subformat.template.vmware_settings — KIWI NG 10.2.1 documentation + kiwi.storage.subformat.template.vmware_settings — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/storage/subformat/vagrant_base.html b/_modules/kiwi/storage/subformat/vagrant_base.html index 67f6bfbc719..20dca85ce8d 100644 --- a/_modules/kiwi/storage/subformat/vagrant_base.html +++ b/_modules/kiwi/storage/subformat/vagrant_base.html @@ -5,14 +5,14 @@ - kiwi.storage.subformat.vagrant_base — KIWI NG 10.2.1 documentation + kiwi.storage.subformat.vagrant_base — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/storage/subformat/vagrant_libvirt.html b/_modules/kiwi/storage/subformat/vagrant_libvirt.html index a6bdc421e2f..c81a6bbf10c 100644 --- a/_modules/kiwi/storage/subformat/vagrant_libvirt.html +++ b/_modules/kiwi/storage/subformat/vagrant_libvirt.html @@ -5,14 +5,14 @@ - kiwi.storage.subformat.vagrant_libvirt — KIWI NG 10.2.1 documentation + kiwi.storage.subformat.vagrant_libvirt — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/storage/subformat/vagrant_virtualbox.html b/_modules/kiwi/storage/subformat/vagrant_virtualbox.html index f4bb98db959..61d130cae1a 100644 --- a/_modules/kiwi/storage/subformat/vagrant_virtualbox.html +++ b/_modules/kiwi/storage/subformat/vagrant_virtualbox.html @@ -5,14 +5,14 @@ - kiwi.storage.subformat.vagrant_virtualbox — KIWI NG 10.2.1 documentation + kiwi.storage.subformat.vagrant_virtualbox — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/storage/subformat/vdi.html b/_modules/kiwi/storage/subformat/vdi.html index 32b83eb9750..8407644be5c 100644 --- a/_modules/kiwi/storage/subformat/vdi.html +++ b/_modules/kiwi/storage/subformat/vdi.html @@ -5,14 +5,14 @@ - kiwi.storage.subformat.vdi — KIWI NG 10.2.1 documentation + kiwi.storage.subformat.vdi — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/storage/subformat/vhd.html b/_modules/kiwi/storage/subformat/vhd.html index 7069eed4389..c59a0818c9e 100644 --- a/_modules/kiwi/storage/subformat/vhd.html +++ b/_modules/kiwi/storage/subformat/vhd.html @@ -5,14 +5,14 @@ - kiwi.storage.subformat.vhd — KIWI NG 10.2.1 documentation + kiwi.storage.subformat.vhd — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/storage/subformat/vhdfixed.html b/_modules/kiwi/storage/subformat/vhdfixed.html index 1694217c4e4..d7a1617d94a 100644 --- a/_modules/kiwi/storage/subformat/vhdfixed.html +++ b/_modules/kiwi/storage/subformat/vhdfixed.html @@ -5,14 +5,14 @@ - kiwi.storage.subformat.vhdfixed — KIWI NG 10.2.1 documentation + kiwi.storage.subformat.vhdfixed — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/storage/subformat/vhdx.html b/_modules/kiwi/storage/subformat/vhdx.html index f94f3c2d48c..e91fd1232df 100644 --- a/_modules/kiwi/storage/subformat/vhdx.html +++ b/_modules/kiwi/storage/subformat/vhdx.html @@ -5,14 +5,14 @@ - kiwi.storage.subformat.vhdx — KIWI NG 10.2.1 documentation + kiwi.storage.subformat.vhdx — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/storage/subformat/vmdk.html b/_modules/kiwi/storage/subformat/vmdk.html index f4ca4fee91a..8b1f3410ea5 100644 --- a/_modules/kiwi/storage/subformat/vmdk.html +++ b/_modules/kiwi/storage/subformat/vmdk.html @@ -5,14 +5,14 @@ - kiwi.storage.subformat.vmdk — KIWI NG 10.2.1 documentation + kiwi.storage.subformat.vmdk — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/system/identifier.html b/_modules/kiwi/system/identifier.html index 9a6c25beed9..7646db7898c 100644 --- a/_modules/kiwi/system/identifier.html +++ b/_modules/kiwi/system/identifier.html @@ -5,14 +5,14 @@ - kiwi.system.identifier — KIWI NG 10.2.1 documentation + kiwi.system.identifier — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/system/kernel.html b/_modules/kiwi/system/kernel.html index 7ca8caf660d..e552301e698 100644 --- a/_modules/kiwi/system/kernel.html +++ b/_modules/kiwi/system/kernel.html @@ -5,14 +5,14 @@ - kiwi.system.kernel — KIWI NG 10.2.1 documentation + kiwi.system.kernel — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/system/prepare.html b/_modules/kiwi/system/prepare.html index df1361cd515..f50086f60cb 100644 --- a/_modules/kiwi/system/prepare.html +++ b/_modules/kiwi/system/prepare.html @@ -5,14 +5,14 @@ - kiwi.system.prepare — KIWI NG 10.2.1 documentation + kiwi.system.prepare — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/system/profile.html b/_modules/kiwi/system/profile.html index 0f84269b3f9..9ef1d848342 100644 --- a/_modules/kiwi/system/profile.html +++ b/_modules/kiwi/system/profile.html @@ -5,14 +5,14 @@ - kiwi.system.profile — KIWI NG 10.2.1 documentation + kiwi.system.profile — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/system/result.html b/_modules/kiwi/system/result.html index 7cfef11190f..f83dea2ee89 100644 --- a/_modules/kiwi/system/result.html +++ b/_modules/kiwi/system/result.html @@ -5,14 +5,14 @@ - kiwi.system.result — KIWI NG 10.2.1 documentation + kiwi.system.result — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/system/root_bind.html b/_modules/kiwi/system/root_bind.html index a4d36e100d8..e114951a9ac 100644 --- a/_modules/kiwi/system/root_bind.html +++ b/_modules/kiwi/system/root_bind.html @@ -5,14 +5,14 @@ - kiwi.system.root_bind — KIWI NG 10.2.1 documentation + kiwi.system.root_bind — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/system/root_init.html b/_modules/kiwi/system/root_init.html index 37d652f8ffd..93d0b9e78a7 100644 --- a/_modules/kiwi/system/root_init.html +++ b/_modules/kiwi/system/root_init.html @@ -5,14 +5,14 @@ - kiwi.system.root_init — KIWI NG 10.2.1 documentation + kiwi.system.root_init — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/system/setup.html b/_modules/kiwi/system/setup.html index c8d533e7321..32d3eb956f3 100644 --- a/_modules/kiwi/system/setup.html +++ b/_modules/kiwi/system/setup.html @@ -5,14 +5,14 @@ - kiwi.system.setup — KIWI NG 10.2.1 documentation + kiwi.system.setup — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/system/shell.html b/_modules/kiwi/system/shell.html index 7e9334c3525..b4c47f2cf5f 100644 --- a/_modules/kiwi/system/shell.html +++ b/_modules/kiwi/system/shell.html @@ -5,14 +5,14 @@ - kiwi.system.shell — KIWI NG 10.2.1 documentation + kiwi.system.shell — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/system/size.html b/_modules/kiwi/system/size.html index 7474aeaee06..ae12dfd7280 100644 --- a/_modules/kiwi/system/size.html +++ b/_modules/kiwi/system/size.html @@ -5,14 +5,14 @@ - kiwi.system.size — KIWI NG 10.2.1 documentation + kiwi.system.size — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/system/uri.html b/_modules/kiwi/system/uri.html index a582725ea9a..ca6fa41dd90 100644 --- a/_modules/kiwi/system/uri.html +++ b/_modules/kiwi/system/uri.html @@ -5,14 +5,14 @@ - kiwi.system.uri — KIWI NG 10.2.1 documentation + kiwi.system.uri — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/system/users.html b/_modules/kiwi/system/users.html index d36c6370445..ce847667334 100644 --- a/_modules/kiwi/system/users.html +++ b/_modules/kiwi/system/users.html @@ -5,14 +5,14 @@ - kiwi.system.users — KIWI NG 10.2.1 documentation + kiwi.system.users — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/tasks/base.html b/_modules/kiwi/tasks/base.html index fa3284d0370..0264a20a894 100644 --- a/_modules/kiwi/tasks/base.html +++ b/_modules/kiwi/tasks/base.html @@ -5,14 +5,14 @@ - kiwi.tasks.base — KIWI NG 10.2.1 documentation + kiwi.tasks.base — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/tasks/result_bundle.html b/_modules/kiwi/tasks/result_bundle.html index 644c4f604ad..27a51a85242 100644 --- a/_modules/kiwi/tasks/result_bundle.html +++ b/_modules/kiwi/tasks/result_bundle.html @@ -5,14 +5,14 @@ - kiwi.tasks.result_bundle — KIWI NG 10.2.1 documentation + kiwi.tasks.result_bundle — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/tasks/result_list.html b/_modules/kiwi/tasks/result_list.html index 7c6f14ee6f5..0fb413cec37 100644 --- a/_modules/kiwi/tasks/result_list.html +++ b/_modules/kiwi/tasks/result_list.html @@ -5,14 +5,14 @@ - kiwi.tasks.result_list — KIWI NG 10.2.1 documentation + kiwi.tasks.result_list — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/tasks/system_build.html b/_modules/kiwi/tasks/system_build.html index f7024ff503c..aa046678778 100644 --- a/_modules/kiwi/tasks/system_build.html +++ b/_modules/kiwi/tasks/system_build.html @@ -5,14 +5,14 @@ - kiwi.tasks.system_build — KIWI NG 10.2.1 documentation + kiwi.tasks.system_build — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/tasks/system_create.html b/_modules/kiwi/tasks/system_create.html index 96762c4aa49..d0beb7ed258 100644 --- a/_modules/kiwi/tasks/system_create.html +++ b/_modules/kiwi/tasks/system_create.html @@ -5,14 +5,14 @@ - kiwi.tasks.system_create — KIWI NG 10.2.1 documentation + kiwi.tasks.system_create — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/tasks/system_prepare.html b/_modules/kiwi/tasks/system_prepare.html index 2a5c8efab2f..eb22cb35418 100644 --- a/_modules/kiwi/tasks/system_prepare.html +++ b/_modules/kiwi/tasks/system_prepare.html @@ -5,14 +5,14 @@ - kiwi.tasks.system_prepare — KIWI NG 10.2.1 documentation + kiwi.tasks.system_prepare — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/tasks/system_update.html b/_modules/kiwi/tasks/system_update.html index 722927b354e..2f26b9b5b9e 100644 --- a/_modules/kiwi/tasks/system_update.html +++ b/_modules/kiwi/tasks/system_update.html @@ -5,14 +5,14 @@ - kiwi.tasks.system_update — KIWI NG 10.2.1 documentation + kiwi.tasks.system_update — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/utils/block.html b/_modules/kiwi/utils/block.html index 7716a8358db..4b65459d143 100644 --- a/_modules/kiwi/utils/block.html +++ b/_modules/kiwi/utils/block.html @@ -5,14 +5,14 @@ - kiwi.utils.block — KIWI NG 10.2.1 documentation + kiwi.utils.block — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/utils/checksum.html b/_modules/kiwi/utils/checksum.html index 4a1ca679b3d..1b468ee9966 100644 --- a/_modules/kiwi/utils/checksum.html +++ b/_modules/kiwi/utils/checksum.html @@ -5,14 +5,14 @@ - kiwi.utils.checksum — KIWI NG 10.2.1 documentation + kiwi.utils.checksum — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/utils/compress.html b/_modules/kiwi/utils/compress.html index 4584f740302..e8e3f142ca4 100644 --- a/_modules/kiwi/utils/compress.html +++ b/_modules/kiwi/utils/compress.html @@ -5,14 +5,14 @@ - kiwi.utils.compress — KIWI NG 10.2.1 documentation + kiwi.utils.compress — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/utils/sync.html b/_modules/kiwi/utils/sync.html index 212f1671fb3..bc2a961cd63 100644 --- a/_modules/kiwi/utils/sync.html +++ b/_modules/kiwi/utils/sync.html @@ -5,14 +5,14 @@ - kiwi.utils.sync — KIWI NG 10.2.1 documentation + kiwi.utils.sync — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/utils/sysconfig.html b/_modules/kiwi/utils/sysconfig.html index 422336fb839..774468feb22 100644 --- a/_modules/kiwi/utils/sysconfig.html +++ b/_modules/kiwi/utils/sysconfig.html @@ -5,14 +5,14 @@ - kiwi.utils.sysconfig — KIWI NG 10.2.1 documentation + kiwi.utils.sysconfig — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/volume_manager.html b/_modules/kiwi/volume_manager.html index 082fe85d747..3062e62134a 100644 --- a/_modules/kiwi/volume_manager.html +++ b/_modules/kiwi/volume_manager.html @@ -5,14 +5,14 @@ - kiwi.volume_manager — KIWI NG 10.2.1 documentation + kiwi.volume_manager — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/volume_manager/base.html b/_modules/kiwi/volume_manager/base.html index 519c5f857eb..3ea275215ba 100644 --- a/_modules/kiwi/volume_manager/base.html +++ b/_modules/kiwi/volume_manager/base.html @@ -5,14 +5,14 @@ - kiwi.volume_manager.base — KIWI NG 10.2.1 documentation + kiwi.volume_manager.base — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/volume_manager/btrfs.html b/_modules/kiwi/volume_manager/btrfs.html index bf5806c138a..95747bd662d 100644 --- a/_modules/kiwi/volume_manager/btrfs.html +++ b/_modules/kiwi/volume_manager/btrfs.html @@ -5,14 +5,14 @@ - kiwi.volume_manager.btrfs — KIWI NG 10.2.1 documentation + kiwi.volume_manager.btrfs — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/volume_manager/lvm.html b/_modules/kiwi/volume_manager/lvm.html index 7cf55d51919..c1b584bc663 100644 --- a/_modules/kiwi/volume_manager/lvm.html +++ b/_modules/kiwi/volume_manager/lvm.html @@ -5,14 +5,14 @@ - kiwi.volume_manager.lvm — KIWI NG 10.2.1 documentation + kiwi.volume_manager.lvm — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/xml_description.html b/_modules/kiwi/xml_description.html index b5b7d232d46..f19cf037170 100644 --- a/_modules/kiwi/xml_description.html +++ b/_modules/kiwi/xml_description.html @@ -5,14 +5,14 @@ - kiwi.xml_description — KIWI NG 10.2.1 documentation + kiwi.xml_description — KIWI NG 10.2.2 documentation - + diff --git a/_modules/kiwi/xml_state.html b/_modules/kiwi/xml_state.html index 9b9f9a7a54c..0d867430095 100644 --- a/_modules/kiwi/xml_state.html +++ b/_modules/kiwi/xml_state.html @@ -5,14 +5,14 @@ - kiwi.xml_state — KIWI NG 10.2.1 documentation + kiwi.xml_state — KIWI NG 10.2.2 documentation - + diff --git a/_static/documentation_options.js b/_static/documentation_options.js index cfc7c1b726c..876cc3968c5 100644 --- a/_static/documentation_options.js +++ b/_static/documentation_options.js @@ -1,5 +1,5 @@ const DOCUMENTATION_OPTIONS = { - VERSION: '10.2.1', + VERSION: '10.2.2', LANGUAGE: 'en', COLLAPSE_INDEX: false, BUILDER: 'html', diff --git a/api.html b/api.html index 5e07fe8bfe5..5519c6021e4 100644 --- a/api.html +++ b/api.html @@ -6,14 +6,14 @@ - Python API — KIWI NG 10.2.1 documentation + Python API — KIWI NG 10.2.2 documentation - + @@ -1243,7 +1243,7 @@

Python API

Note

-

This API documentation covers KIWI NG 10.2.1

+

This API documentation covers KIWI NG 10.2.2

    diff --git a/api/kiwi.archive.html b/api/kiwi.archive.html index f955fd93a8a..dac9a416b01 100644 --- a/api/kiwi.archive.html +++ b/api/kiwi.archive.html @@ -6,14 +6,14 @@ - kiwi.archive Package — KIWI NG 10.2.1 documentation + kiwi.archive Package — KIWI NG 10.2.2 documentation - + diff --git a/api/kiwi.boot.html b/api/kiwi.boot.html index 2144e0128c1..986b153d45a 100644 --- a/api/kiwi.boot.html +++ b/api/kiwi.boot.html @@ -6,14 +6,14 @@ - kiwi.boot Package — KIWI NG 10.2.1 documentation + kiwi.boot Package — KIWI NG 10.2.2 documentation - + diff --git a/api/kiwi.boot.image.html b/api/kiwi.boot.image.html index d0d6a59f6f4..3b4c91bc087 100644 --- a/api/kiwi.boot.image.html +++ b/api/kiwi.boot.image.html @@ -6,14 +6,14 @@ - kiwi.boot.image Package — KIWI NG 10.2.1 documentation + kiwi.boot.image Package — KIWI NG 10.2.2 documentation - + diff --git a/api/kiwi.bootloader.config.html b/api/kiwi.bootloader.config.html index c2bca4ce974..147ed49b6c8 100644 --- a/api/kiwi.bootloader.config.html +++ b/api/kiwi.bootloader.config.html @@ -6,14 +6,14 @@ - kiwi.bootloader.config Package — KIWI NG 10.2.1 documentation + kiwi.bootloader.config Package — KIWI NG 10.2.2 documentation - + diff --git a/api/kiwi.bootloader.html b/api/kiwi.bootloader.html index 09f2a0adb3f..0e6803177fd 100644 --- a/api/kiwi.bootloader.html +++ b/api/kiwi.bootloader.html @@ -6,14 +6,14 @@ - kiwi.bootloader Package — KIWI NG 10.2.1 documentation + kiwi.bootloader Package — KIWI NG 10.2.2 documentation - + diff --git a/api/kiwi.bootloader.install.html b/api/kiwi.bootloader.install.html index 648c6b2cc75..5b79cd0fc61 100644 --- a/api/kiwi.bootloader.install.html +++ b/api/kiwi.bootloader.install.html @@ -6,14 +6,14 @@ - kiwi.bootloader.install Package — KIWI NG 10.2.1 documentation + kiwi.bootloader.install Package — KIWI NG 10.2.2 documentation - + diff --git a/api/kiwi.bootloader.template.html b/api/kiwi.bootloader.template.html index eeb2eb49a76..3e1344efa1e 100644 --- a/api/kiwi.bootloader.template.html +++ b/api/kiwi.bootloader.template.html @@ -6,14 +6,14 @@ - kiwi.bootloader.template Package — KIWI NG 10.2.1 documentation + kiwi.bootloader.template Package — KIWI NG 10.2.2 documentation - + diff --git a/api/kiwi.builder.html b/api/kiwi.builder.html index 350f90f8033..09af8e64bc0 100644 --- a/api/kiwi.builder.html +++ b/api/kiwi.builder.html @@ -6,14 +6,14 @@ - kiwi.builder Package — KIWI NG 10.2.1 documentation + kiwi.builder Package — KIWI NG 10.2.2 documentation - + diff --git a/api/kiwi.container.html b/api/kiwi.container.html index ff5cf983728..9d2300e01a6 100644 --- a/api/kiwi.container.html +++ b/api/kiwi.container.html @@ -6,14 +6,14 @@ - kiwi.container Package — KIWI NG 10.2.1 documentation + kiwi.container Package — KIWI NG 10.2.2 documentation - + diff --git a/api/kiwi.container.setup.html b/api/kiwi.container.setup.html index 5a9a6357da8..549e114d640 100644 --- a/api/kiwi.container.setup.html +++ b/api/kiwi.container.setup.html @@ -6,14 +6,14 @@ - kiwi.container.setup Package — KIWI NG 10.2.1 documentation + kiwi.container.setup Package — KIWI NG 10.2.2 documentation - + diff --git a/api/kiwi.filesystem.html b/api/kiwi.filesystem.html index dca0074ad67..c7d96bd3c68 100644 --- a/api/kiwi.filesystem.html +++ b/api/kiwi.filesystem.html @@ -6,14 +6,14 @@ - kiwi.filesystem Package — KIWI NG 10.2.1 documentation + kiwi.filesystem Package — KIWI NG 10.2.2 documentation - + diff --git a/api/kiwi.html b/api/kiwi.html index 1e5f57caf38..995706c3e11 100644 --- a/api/kiwi.html +++ b/api/kiwi.html @@ -6,14 +6,14 @@ - kiwi Package — KIWI NG 10.2.1 documentation + kiwi Package — KIWI NG 10.2.2 documentation - + diff --git a/api/kiwi.iso_tools.html b/api/kiwi.iso_tools.html index 14c3c97a14b..a4a356db093 100644 --- a/api/kiwi.iso_tools.html +++ b/api/kiwi.iso_tools.html @@ -6,14 +6,14 @@ - kiwi.iso_tools Package — KIWI NG 10.2.1 documentation + kiwi.iso_tools Package — KIWI NG 10.2.2 documentation - + diff --git a/api/kiwi.package_manager.html b/api/kiwi.package_manager.html index dc9179408fb..6d5d9219cf0 100644 --- a/api/kiwi.package_manager.html +++ b/api/kiwi.package_manager.html @@ -6,14 +6,14 @@ - kiwi.package_manager Package — KIWI NG 10.2.1 documentation + kiwi.package_manager Package — KIWI NG 10.2.2 documentation - + diff --git a/api/kiwi.partitioner.html b/api/kiwi.partitioner.html index 82a3e851354..9a9068ea61f 100644 --- a/api/kiwi.partitioner.html +++ b/api/kiwi.partitioner.html @@ -6,14 +6,14 @@ - kiwi.partitioner Package — KIWI NG 10.2.1 documentation + kiwi.partitioner Package — KIWI NG 10.2.2 documentation - + diff --git a/api/kiwi.repository.html b/api/kiwi.repository.html index 6338f32b6a8..052e689fecc 100644 --- a/api/kiwi.repository.html +++ b/api/kiwi.repository.html @@ -6,14 +6,14 @@ - kiwi.repository Package — KIWI NG 10.2.1 documentation + kiwi.repository Package — KIWI NG 10.2.2 documentation - + diff --git a/api/kiwi.repository.template.html b/api/kiwi.repository.template.html index 635a4ef05d2..d417c58ada0 100644 --- a/api/kiwi.repository.template.html +++ b/api/kiwi.repository.template.html @@ -6,14 +6,14 @@ - kiwi.repository.template Package — KIWI NG 10.2.1 documentation + kiwi.repository.template Package — KIWI NG 10.2.2 documentation - + diff --git a/api/kiwi.solver.html b/api/kiwi.solver.html index 784e7e35c47..557cfce7c75 100644 --- a/api/kiwi.solver.html +++ b/api/kiwi.solver.html @@ -6,14 +6,14 @@ - kiwi.solver Package — KIWI NG 10.2.1 documentation + kiwi.solver Package — KIWI NG 10.2.2 documentation - + diff --git a/api/kiwi.solver.repository.html b/api/kiwi.solver.repository.html index 7a748ff2fb9..ae3a270fae2 100644 --- a/api/kiwi.solver.repository.html +++ b/api/kiwi.solver.repository.html @@ -6,14 +6,14 @@ - kiwi.solver.repository Package — KIWI NG 10.2.1 documentation + kiwi.solver.repository Package — KIWI NG 10.2.2 documentation - + diff --git a/api/kiwi.storage.html b/api/kiwi.storage.html index c072c68b275..bc63563e859 100644 --- a/api/kiwi.storage.html +++ b/api/kiwi.storage.html @@ -6,14 +6,14 @@ - kiwi.storage Package — KIWI NG 10.2.1 documentation + kiwi.storage Package — KIWI NG 10.2.2 documentation - + diff --git a/api/kiwi.storage.subformat.html b/api/kiwi.storage.subformat.html index 47471927ce1..697279baf5b 100644 --- a/api/kiwi.storage.subformat.html +++ b/api/kiwi.storage.subformat.html @@ -6,14 +6,14 @@ - kiwi.storage.subformat Package — KIWI NG 10.2.1 documentation + kiwi.storage.subformat Package — KIWI NG 10.2.2 documentation - + diff --git a/api/kiwi.storage.subformat.template.html b/api/kiwi.storage.subformat.template.html index dbe7250fd9a..65a84334f75 100644 --- a/api/kiwi.storage.subformat.template.html +++ b/api/kiwi.storage.subformat.template.html @@ -6,14 +6,14 @@ - kiwi.storage.subformat.template Package — KIWI NG 10.2.1 documentation + kiwi.storage.subformat.template Package — KIWI NG 10.2.2 documentation - + diff --git a/api/kiwi.system.html b/api/kiwi.system.html index 4b966a9a20a..d9415ff33ff 100644 --- a/api/kiwi.system.html +++ b/api/kiwi.system.html @@ -6,14 +6,14 @@ - kiwi.system Package — KIWI NG 10.2.1 documentation + kiwi.system Package — KIWI NG 10.2.2 documentation - + diff --git a/api/kiwi.tasks.html b/api/kiwi.tasks.html index 940f18cc1bc..2732ff2f1dc 100644 --- a/api/kiwi.tasks.html +++ b/api/kiwi.tasks.html @@ -6,14 +6,14 @@ - kiwi.tasks package — KIWI NG 10.2.1 documentation + kiwi.tasks package — KIWI NG 10.2.2 documentation - + diff --git a/api/kiwi.utils.html b/api/kiwi.utils.html index 60b0d73d663..9adde7895fa 100644 --- a/api/kiwi.utils.html +++ b/api/kiwi.utils.html @@ -6,14 +6,14 @@ - kiwi.utils Package — KIWI NG 10.2.1 documentation + kiwi.utils Package — KIWI NG 10.2.2 documentation - + diff --git a/api/kiwi.volume_manager.html b/api/kiwi.volume_manager.html index bb4dbfd872f..c294decb383 100644 --- a/api/kiwi.volume_manager.html +++ b/api/kiwi.volume_manager.html @@ -6,14 +6,14 @@ - kiwi.volume_manager Package — KIWI NG 10.2.1 documentation + kiwi.volume_manager Package — KIWI NG 10.2.2 documentation - + diff --git a/building_images.html b/building_images.html index 488132e735c..93e3b8ef8f8 100644 --- a/building_images.html +++ b/building_images.html @@ -6,14 +6,14 @@ - Building Images for Supported Types — KIWI NG 10.2.1 documentation + Building Images for Supported Types — KIWI NG 10.2.2 documentation - + diff --git a/building_images/build_container_image.html b/building_images/build_container_image.html index 3d082361528..d74a5dd22bb 100644 --- a/building_images/build_container_image.html +++ b/building_images/build_container_image.html @@ -6,14 +6,14 @@ - Build a Container Image — KIWI NG 10.2.1 documentation + Build a Container Image — KIWI NG 10.2.2 documentation - + diff --git a/building_images/build_enclave.html b/building_images/build_enclave.html index 9a22e1ebc1e..474a5d8cb4c 100644 --- a/building_images/build_enclave.html +++ b/building_images/build_enclave.html @@ -6,14 +6,14 @@ - Build an AWS Nitro Enclave — KIWI NG 10.2.1 documentation + Build an AWS Nitro Enclave — KIWI NG 10.2.2 documentation - + diff --git a/building_images/build_expandable_disk.html b/building_images/build_expandable_disk.html index 4d862ef86cf..a32ac494b36 100644 --- a/building_images/build_expandable_disk.html +++ b/building_images/build_expandable_disk.html @@ -6,14 +6,14 @@ - Build an Expandable Disk Image — KIWI NG 10.2.1 documentation + Build an Expandable Disk Image — KIWI NG 10.2.2 documentation - + diff --git a/building_images/build_kis.html b/building_images/build_kis.html index 290545379b6..c2705899259 100644 --- a/building_images/build_kis.html +++ b/building_images/build_kis.html @@ -6,14 +6,14 @@ - Build KIS Image (Kernel, Initrd, System) — KIWI NG 10.2.1 documentation + Build KIS Image (Kernel, Initrd, System) — KIWI NG 10.2.2 documentation - + diff --git a/building_images/build_live_iso.html b/building_images/build_live_iso.html index ddbb034574c..8d21fb4980e 100644 --- a/building_images/build_live_iso.html +++ b/building_images/build_live_iso.html @@ -6,14 +6,14 @@ - Build an ISO Hybrid Live Image — KIWI NG 10.2.1 documentation + Build an ISO Hybrid Live Image — KIWI NG 10.2.2 documentation - + diff --git a/building_images/build_simple_disk.html b/building_images/build_simple_disk.html index cffa6f2573a..7298b985e2c 100644 --- a/building_images/build_simple_disk.html +++ b/building_images/build_simple_disk.html @@ -6,14 +6,14 @@ - Build a Virtual Disk Image — KIWI NG 10.2.1 documentation + Build a Virtual Disk Image — KIWI NG 10.2.2 documentation - + diff --git a/building_images/build_wsl_container.html b/building_images/build_wsl_container.html index 61c72cd42c4..0fc126aad4d 100644 --- a/building_images/build_wsl_container.html +++ b/building_images/build_wsl_container.html @@ -6,14 +6,14 @@ - Build a WSL Container Image — KIWI NG 10.2.1 documentation + Build a WSL Container Image — KIWI NG 10.2.2 documentation - + diff --git a/commands.html b/commands.html index 8f922c3236f..52a820ab2dd 100644 --- a/commands.html +++ b/commands.html @@ -6,14 +6,14 @@ - Working from the Command Line — KIWI NG 10.2.1 documentation + Working from the Command Line — KIWI NG 10.2.2 documentation - + @@ -1244,7 +1244,7 @@

    Working from the Command Line

    Note

    This document provides a list of the existing KIWI Next Generation (KIWI NG) commands -for version 10.2.1.

    +for version 10.2.2.

    diff --git a/concept_and_workflow/customize_the_boot_process.html b/concept_and_workflow/customize_the_boot_process.html index 676772e1b67..ea6cd31cae2 100644 --- a/concept_and_workflow/customize_the_boot_process.html +++ b/concept_and_workflow/customize_the_boot_process.html @@ -6,14 +6,14 @@ - Customizing the Boot Process — KIWI NG 10.2.1 documentation + Customizing the Boot Process — KIWI NG 10.2.2 documentation - + diff --git a/concept_and_workflow/packages.html b/concept_and_workflow/packages.html index 340743cad97..68e90a4df83 100644 --- a/concept_and_workflow/packages.html +++ b/concept_and_workflow/packages.html @@ -6,14 +6,14 @@ - Adding and Removing Packages — KIWI NG 10.2.1 documentation + Adding and Removing Packages — KIWI NG 10.2.2 documentation - + diff --git a/concept_and_workflow/profiles.html b/concept_and_workflow/profiles.html index 2b1a9edc7da..170df611dd4 100644 --- a/concept_and_workflow/profiles.html +++ b/concept_and_workflow/profiles.html @@ -6,14 +6,14 @@ - Image Profiles — KIWI NG 10.2.1 documentation + Image Profiles — KIWI NG 10.2.2 documentation - + diff --git a/concept_and_workflow/repository_setup.html b/concept_and_workflow/repository_setup.html index 4bc4990a13b..399a81f3781 100644 --- a/concept_and_workflow/repository_setup.html +++ b/concept_and_workflow/repository_setup.html @@ -6,14 +6,14 @@ - Setting up Repositories — KIWI NG 10.2.1 documentation + Setting up Repositories — KIWI NG 10.2.2 documentation - + diff --git a/concept_and_workflow/runtime_configuration.html b/concept_and_workflow/runtime_configuration.html index 4151d718b11..cf6d3c9d44d 100644 --- a/concept_and_workflow/runtime_configuration.html +++ b/concept_and_workflow/runtime_configuration.html @@ -6,14 +6,14 @@ - The Runtime Configuration File — KIWI NG 10.2.1 documentation + The Runtime Configuration File — KIWI NG 10.2.2 documentation - + diff --git a/concept_and_workflow/shell_scripts.html b/concept_and_workflow/shell_scripts.html index 5418a48ace2..104df133bf7 100644 --- a/concept_and_workflow/shell_scripts.html +++ b/concept_and_workflow/shell_scripts.html @@ -6,14 +6,14 @@ - User-Defined Scripts — KIWI NG 10.2.1 documentation + User-Defined Scripts — KIWI NG 10.2.2 documentation - + diff --git a/concept_and_workflow/systemdeps.html b/concept_and_workflow/systemdeps.html index 9e34e6a7f60..c88aaf6f5d6 100644 --- a/concept_and_workflow/systemdeps.html +++ b/concept_and_workflow/systemdeps.html @@ -6,14 +6,14 @@ - Host Requirements To Build Images — KIWI NG 10.2.1 documentation + Host Requirements To Build Images — KIWI NG 10.2.2 documentation - + diff --git a/concept_and_workflow/users.html b/concept_and_workflow/users.html index dcaaf903d74..7948142fc6b 100644 --- a/concept_and_workflow/users.html +++ b/concept_and_workflow/users.html @@ -6,14 +6,14 @@ - Adding Users — KIWI NG 10.2.1 documentation + Adding Users — KIWI NG 10.2.2 documentation - + diff --git a/contributing.html b/contributing.html index 6953ee070dc..e16f06f9be1 100644 --- a/contributing.html +++ b/contributing.html @@ -6,14 +6,14 @@ - Contributing — KIWI NG 10.2.1 documentation + Contributing — KIWI NG 10.2.2 documentation - + @@ -1246,7 +1246,7 @@

    Contributing
      diff --git a/contributing/kiwi_from_python.html b/contributing/kiwi_from_python.html index c087413c3c0..5e161e001d4 100644 --- a/contributing/kiwi_from_python.html +++ b/contributing/kiwi_from_python.html @@ -6,14 +6,14 @@ - Using KIWI NG in a Python Project — KIWI NG 10.2.1 documentation + Using KIWI NG in a Python Project — KIWI NG 10.2.2 documentation - + @@ -1247,7 +1247,7 @@

      Using KIWI NG in a Python Project - Plugin Architecture — KIWI NG 10.2.1 documentation + Plugin Architecture — KIWI NG 10.2.2 documentation - + diff --git a/contributing/schema_extensions.html b/contributing/schema_extensions.html index 02a8a74a5a7..ae0da966366 100644 --- a/contributing/schema_extensions.html +++ b/contributing/schema_extensions.html @@ -6,14 +6,14 @@ - Extending KIWI NG with Custom Operations — KIWI NG 10.2.1 documentation + Extending KIWI NG with Custom Operations — KIWI NG 10.2.2 documentation - + @@ -1257,7 +1257,7 @@

      Extending KIWI NG with Custom Operations

      The <extension> Section

      diff --git a/contributing/scripts_testing.html b/contributing/scripts_testing.html index badddc9ccae..1212eb4b828 100644 --- a/contributing/scripts_testing.html +++ b/contributing/scripts_testing.html @@ -6,14 +6,14 @@ - Write Integration Tests for the Scripts — KIWI NG 10.2.1 documentation + Write Integration Tests for the Scripts — KIWI NG 10.2.2 documentation - + diff --git a/genindex.html b/genindex.html index 9ecf2519b3a..e3b4e51f5b2 100644 --- a/genindex.html +++ b/genindex.html @@ -5,14 +5,14 @@ - Index — KIWI NG 10.2.1 documentation + Index — KIWI NG 10.2.2 documentation - + diff --git a/image_description.html b/image_description.html index fa84fc4b803..00f0ebfd2f4 100644 --- a/image_description.html +++ b/image_description.html @@ -6,14 +6,14 @@ - Image Description — KIWI NG 10.2.1 documentation + Image Description — KIWI NG 10.2.2 documentation - + @@ -1244,7 +1244,7 @@

      Note

      This document explains the toplevel structure of the -KIWI NG image description document for version 10.2.1

      +KIWI NG image description document for version 10.2.2

        diff --git a/image_description/elements.html b/image_description/elements.html index df0839323d9..9ad07d3f95c 100644 --- a/image_description/elements.html +++ b/image_description/elements.html @@ -6,14 +6,14 @@ - Image Description Elements — KIWI NG 10.2.1 documentation + Image Description Elements — KIWI NG 10.2.2 documentation - + @@ -1245,7 +1245,7 @@

        Note

        This document provides a reference for the elements -and attributes of the KIWI NG XML document in version 10.2.1

        +and attributes of the KIWI NG XML document in version 10.2.2

        <image>

        diff --git a/image_types_and_results.html b/image_types_and_results.html index 1f31d040af0..f904bb69fbf 100644 --- a/image_types_and_results.html +++ b/image_types_and_results.html @@ -6,14 +6,14 @@ - Image Types — KIWI NG 10.2.1 documentation + Image Types — KIWI NG 10.2.2 documentation - + diff --git a/index.html b/index.html index 225842e3f37..a824a4f94fb 100644 --- a/index.html +++ b/index.html @@ -6,14 +6,14 @@ - Building Linux System Appliances — KIWI NG 10.2.1 documentation + Building Linux System Appliances — KIWI NG 10.2.2 documentation - + @@ -1242,7 +1242,7 @@

        Building Linux System Appliances

        Note

        -

        This documentation covers KIWI Next Generation (KIWI NG) 10.2.1- the command line +

        This documentation covers KIWI Next Generation (KIWI NG) 10.2.2- the command line utility to build Linux system appliances. If you are using a KIWI NG schema version older than v74, upgrade the kiwi file as follows:

        $ xsltproc /usr/share/kiwi/xsl_to_v74/update.xsl config.xml|*.kiwi
diff --git a/installation.html b/installation.html
index c78ab7d2f5a..f2cc1f1beed 100644
--- a/installation.html
+++ b/installation.html
@@ -6,14 +6,14 @@
   
 
   
-  Installation — KIWI NG 10.2.1 documentation
+  Installation — KIWI NG 10.2.2 documentation
       
       
 
   
       
       
-      
+      
       
       
     
diff --git a/objects.inv b/objects.inv
index cb2d84b179ce7db0a1c54b4ce56ac43b0e0a4022..40e2e68d1b67dfa056b00cb5a4260b2fe12034a9 100644
GIT binary patch
delta 12
Tcmexb{k3|61EbMK$1S!1D
 
   
-  Overview — KIWI NG 10.2.1 documentation
+  Overview — KIWI NG 10.2.2 documentation
       
       
 
   
       
       
-      
+      
       
       
     
@@ -1247,7 +1247,7 @@
 
        This document provides a conceptual overview about the steps
 of creating an image with KIWI NG. It also explains the terminology
 regarding the concept and process when building system images
-with KIWI NG 10.2.1.
        
+with KIWI NG 10.2.2.
          diff --git a/plugins/self_contained.html b/plugins/self_contained.html index 6871188414f..7f30d75c609 100644 --- a/plugins/self_contained.html +++ b/plugins/self_contained.html @@ -6,14 +6,14 @@ - Building in a Self-Contained Environment — KIWI NG 10.2.1 documentation + Building in a Self-Contained Environment — KIWI NG 10.2.2 documentation - + diff --git a/plugins/stackbuild.html b/plugins/stackbuild.html index 9bb0eb052d3..0db755fe0c7 100644 --- a/plugins/stackbuild.html +++ b/plugins/stackbuild.html @@ -6,14 +6,14 @@ - Building based on Containers — KIWI NG 10.2.1 documentation + Building based on Containers — KIWI NG 10.2.2 documentation - + diff --git a/py-modindex.html b/py-modindex.html index f80e6c2de33..ccb622b7903 100644 --- a/py-modindex.html +++ b/py-modindex.html @@ -5,14 +5,14 @@ - Python Module Index — KIWI NG 10.2.1 documentation + Python Module Index — KIWI NG 10.2.2 documentation - + diff --git a/quickstart.html b/quickstart.html index 246afb3200b..962629735e6 100644 --- a/quickstart.html +++ b/quickstart.html @@ -6,14 +6,14 @@ - Quick Start — KIWI NG 10.2.1 documentation + Quick Start — KIWI NG 10.2.2 documentation - + @@ -1246,7 +1246,7 @@

          Abstract

          This document describes how to start working with KIWI NG, an OS appliance builder. This description applies for -version 10.2.1.

          +version 10.2.2.

        Before you start

        diff --git a/search.html b/search.html index 0b323c3f561..b096dcc1783 100644 --- a/search.html +++ b/search.html @@ -5,7 +5,7 @@ - Search — KIWI NG 10.2.1 documentation + Search — KIWI NG 10.2.2 documentation @@ -13,7 +13,7 @@ - + diff --git a/searchindex.js b/searchindex.js index f357e26fcb8..2c3cd83a1b2 100644 --- a/searchindex.js +++ b/searchindex.js @@ -1 +1 @@ -Search.setIndex({"alltitles": {"": [[60, "containers"]], "": [[60, "containers-container"]], "": [[60, "description"]], "": [[60, "image"]], "": [[60, "include"]], "": [[60, "packages"]], "": [[60, "packages-archive"]], "": [[60, "packages-collectionmodule"]], "": [[60, "packages-file"]], "": [[60, "packages-ignore"]], "": [[60, "packages-namedcollection"]], "": [[60, "packages-package"]], "": [[60, "packages-product"]], "": [[60, "preferences"]], "": [[60, "preferences-bootloader-theme"]], "": [[60, "preferences-bootsplash-theme"]], "": [[60, "preferences-keytable"]], "": [[60, "preferences-locale"]], "": [[60, "preferences-packagemanager"]], "": [[60, "preferences-release-version"]], "": [[60, "preferences-rpm-check-signatures"]], "": [[60, "preferences-rpm-excludedocs"]], "": [[60, "preferences-rpm-locale-filtering"]], "": [[60, "preferences-timezone"]], "": [[60, "preferences-type"]], "": [[60, "preferences-type-bootloader"]], "": [[60, "preferences-type-bootloader-bootloadersettings"]], "": [[60, "preferences-type-bootloader-securelinux"]], "": [[60, "preferences-type-containerconfig"]], "": [[60, "preferences-type-installmedia"]], "": [[60, "preferences-type-luksformat"]], "": [[60, "preferences-type-machine"]], "": [[60, "preferences-type-oemconfig"]], "": [[60, "preferences-type-partitions"]], "": [[60, "preferences-type-size"]], "": [[60, "preferences-type-systemdisk"]], "": [[60, "preferences-type-vagrantconfig"]], "": [[60, "preferences-version"]], "": [[60, "profiles"]], "": [[60, "repository"]], "": [[60, "repository-source"]], "": [[60, "users"]], "Abstract": [[28, null], [29, null], [30, null], [31, null], [32, null], [33, null], [34, null], [79, null], [80, null], [81, null], [82, null], [83, null], [84, null], [85, null], [86, null], [87, null], [88, null], [89, null], [90, null], [91, null], [92, null], [93, null], [94, null], [95, null], [96, null], [97, null], [98, null]], "Add or Update the Fstab File": [[81, null]], "Adding CD/DVD Drives": [[33, "adding-cd-dvd-drives"]], "Adding Network Interfaces to the VM": [[33, "adding-network-interfaces-to-the-vm"]], "Adding Users": [[53, null]], "Adding and Removing Packages": [[47, null]], "Adding repositories": [[49, "adding-repositories"]], "Additional Information": [[54, "additional-information"]], "Advantages of using the Open Build Service (OBS)": [[77, "advantages-of-using-the-open-build-service-obs"]], "Architectures": [[71, null]], "Basic Workflow": [[65, null]], "Before you start": [[69, "before-you-start"]], "Boot Debugging": [[46, "boot-debugging"]], "Boot Image Hook-Scripts": [[46, "boot-image-hook-scripts"]], "Boot Image Parameters": [[46, "boot-image-parameters"]], "Booting a Live ISO Image from Network": [[94, null]], "Booting a Live ISO Images from Grub2": [[92, null]], "Booting a Root Filesystem from Network": [[95, null]], "Boxbuild Tweaks": [[72, null]], "Build Host Constraints": [[73, null]], "Build KIS Image (Kernel, Initrd, System)": [[31, null]], "Build PXE Root File System Image for the legacy netboot infrastructure": [[93, null]], "Build a Container Image": [[28, null]], "Build a Virtual Disk Image": [[33, null]], "Build a WSL Container Image": [[34, null]], "Build an AWS Nitro Enclave": [[29, null]], "Build an Expandable Disk Image": [[30, null]], "Build an ISO Hybrid Live Image": [[32, null]], "Build your First Image": [[69, "build-your-first-image"]], "Building Images for Supported Types": [[27, null]], "Building Images with Profiles": [[78, null]], "Building Linux System Appliances": [[62, null]], "Building based on Containers": [[68, null]], "Building in a Self-Contained Environment": [[67, null]], "Building in the Open Build Service": [[77, null]], "Building with the Open Build Service": [[78, "building-with-the-open-build-service"]], "Building with the boxbuild command": [[67, "building-with-the-boxbuild-command"]], "Bumping the Version": [[54, "bumping-the-version"]], "CD/DVD Deployment": [[30, "cd-dvd-deployment"]], "Choose a First Image": [[69, "choose-a-first-image"]], "Circumvent Debian Bootstrap": [[79, null]], "Coding Style": [[54, "coding-style"]], "Components of an Image Description": [[65, "components-of-an-image-description"]], "Concept": [[68, "concept"]], "Concept and Workflow": [[45, null]], "Conceptual Overview": [[64, "conceptual-overview"]], "Configuration Tips": [[51, "configuration-tips"]], "Contact": [[62, "contact"]], "Contributing": [[54, null]], "Create a Branch for each Feature or Bugfix": [[54, "create-a-branch-for-each-feature-or-bugfix"]], "Create a Python Virtual Development Environment": [[54, "create-a-python-virtual-development-environment"]], "Create a local clone of the forked repository": [[54, "create-a-local-clone-of-the-forked-repository"]], "Create a stash": [[68, "create-a-stash"]], "Creating a RPM Package": [[54, "creating-a-rpm-package"]], "Custom Disk Partitions": [[82, null]], "Custom Disk Volumes": [[83, null]], "Customizing the Boot Process": [[46, null]], "Customizing the Virtual Machine": [[33, "customizing-the-virtual-machine"]], "Customizing the embedded Vagrantfile": [[89, "customizing-the-embedded-vagrantfile"]], "DESCRIPTION": [[36, "description"], [37, "description"], [38, "description"], [39, "description"], [40, "description"], [41, "description"], [42, "description"], [43, "description"], [44, "description"]], "Deploy ISO Image as File on a FAT32 Formated USB Stick": [[91, null]], "Deploy ISO Image on an USB Stick": [[90, null]], "Deploy and Run System in a RamDisk": [[84, null]], "Deployment Methods": [[30, "deployment-methods"]], "Developing/Debugging Scripts": [[51, "developing-debugging-scripts"]], "Differences Between Building Locally and on OBS": [[77, "differences-between-building-locally-and-on-obs"]], "Documentation": [[54, "documentation"]], "EXAMPLE": [[38, "example"]], "Example Appliance Descriptions": [[63, "example-appliance-descriptions"]], "Example plugin": [[56, "example-plugin"]], "Extending KIWI NG with Custom Operations": [[57, null]], "Extension schema in XML catalog": [[57, "extension-schema-in-xml-catalog"]], "Fork the upstream repository": [[54, "fork-the-upstream-repository"]], "Functions": [[51, "functions"]], "Functions and Variables Provided by KIWI NG": [[51, "functions-and-variables-provided-by-kiwi-ng"]], "GLOBAL OPTIONS": [[38, "global-options"]], "Host Requirements To Build Images": [[52, null]], "Host Security Settings Conflicts with KIWI": [[75, null]], "How to Create a bootstrap_package": [[79, "how-to-create-a-bootstrap-package"]], "Image Building Process": [[45, "image-building-process"]], "Image Bundle Format": [[61, "image-bundle-format"]], "Image Content Setup": [[59, "image-content-setup"]], "Image Description": [[59, null]], "Image Description Elements": [[60, null]], "Image Description Encrypted Disk": [[88, null]], "Image Description for Amazon EC2": [[86, null]], "Image Description for Google Compute Engine": [[87, null]], "Image Description for Microsoft Azure": [[85, null]], "Image Description for Vagrant": [[89, null]], "Image Identity": [[59, "image-identity"]], "Image Includes": [[59, "image-includes"]], "Image Namespace": [[59, "image-namespace"]], "Image Preferences": [[59, "image-preferences"]], "Image Profiles": [[48, null]], "Image Results": [[61, "image-results"]], "Image Software Sources": [[59, "image-software-sources"]], "Image Types": [[61, null]], "Image Users": [[59, "image-users"]], "Incompatible Filesystem Settings on Host vs. Image": [[74, null]], "Increase Box Build Image Size": [[72, "increase-box-build-image-size"]], "Install Required Operating System Packages": [[54, "install-required-operating-system-packages"]], "Installation": [[63, null], [68, "installation"]], "Installation Media Customization": [[30, "installation-media-customization"]], "Installation for SUSE Linux Enterprise": [[63, "installation-for-suse-linux-enterprise"]], "Installation from Distribution Repositories": [[63, "installation-from-distribution-repositories"]], "Installation from OBS": [[63, "installation-from-obs"]], "Installing and Configuring DHCP and TFTP with dnsmasq": [[96, "installing-and-configuring-dhcp-and-tftp-with-dnsmasq"]], "KIWI Plugins": [[66, null]], "Links": [[62, null]], "Local Builds": [[78, "local-builds"]], "Main Root": [[59, "main-root"]], "Manual Deployment": [[30, "manual-deployment"]], "Modifying the Size of the Image": [[33, "modifying-the-size-of-the-image"]], "Modifying the VM Configuration Directly": [[33, "modifying-the-vm-configuration-directly"]], "Module Contents": [[1, "module-kiwi"], [2, "module-kiwi.archive"], [3, "module-kiwi.boot"], [4, "module-kiwi.boot.image"], [5, "module-kiwi.bootloader"], [6, "module-kiwi.bootloader.config"], [7, "module-kiwi.bootloader.install"], [8, "module-kiwi.bootloader.template"], [9, "module-kiwi.builder"], [10, "module-kiwi.container"], [11, "module-kiwi.container.setup"], [12, "module-kiwi.filesystem"], [13, "module-kiwi.iso_tools"], [14, "module-kiwi.package_manager"], [15, "module-kiwi.partitioner"], [16, "module-kiwi.repository"], [17, "module-kiwi.repository.template"], [18, "module-kiwi.solver"], [19, "module-kiwi.solver.repository"], [20, "module-kiwi.storage"], [21, "module-kiwi.storage.subformat"], [23, "module-kiwi.system"], [24, "module-kiwi.tasks"], [25, "module-kiwi.utils"], [26, "module-kiwi.volume_manager"]], "Module contents": [[22, "module-kiwi.storage.subformat.template"]], "Naming conventions": [[56, "naming-conventions"]], "Network Deployment": [[30, "network-deployment"]], "OEM Customization": [[30, "oem-customization"]], "OPTIONS": [[36, "options"], [37, "options"], [39, "options"], [40, "options"], [41, "options"], [42, "options"], [43, "options"], [44, "options"]], "Overview": [[45, "overview"], [64, null]], "PXE Client Setup Configuration": [[93, "pxe-client-setup-configuration"]], "Partition Clones": [[80, null]], "Plugin Architecture": [[56, null]], "Profile Environment Variables": [[51, "profile-environment-variables"]], "Project Configuration": [[77, "project-configuration"]], "Python API": [[0, null]], "Quick Start": [[69, null]], "RELAX NG Schema for the Extension": [[57, "relax-ng-schema-for-the-extension"]], "Rebuild from a stash": [[68, "rebuild-from-a-stash"]], "Recommendations": [[77, "recommendations"]], "Repository Configuration": [[77, "repository-configuration"]], "Requirements": [[67, "requirements"]], "Run your Image": [[69, "run-your-image"]], "Running the Unit Tests": [[54, "running-the-unit-tests"]], "SYNOPSIS": [[36, "synopsis"], [37, "synopsis"], [38, "synopsis"], [39, "synopsis"], [40, "synopsis"], [41, "synopsis"], [42, "synopsis"], [43, "synopsis"], [44, "synopsis"]], "Script Template for config.sh / images.sh": [[51, "script-template-for-config-sh-images-sh"]], "Setting Up YaST at First Boot": [[97, null]], "Setting Up a Network Boot Server": [[96, null]], "Setting up Repositories": [[49, null]], "Setting up the Bootloader in the Image": [[33, "setting-up-the-bootloader-in-the-image"]], "Setup Client for Reboot After Deployment": [[93, "setup-client-for-reboot-after-deployment"]], "Setup Client to Force Reload Configuration Files": [[93, "setup-client-to-force-reload-configuration-files"]], "Setup Client to Force Reload Image": [[93, "setup-client-to-force-reload-image"]], "Setup Client with Remote Root": [[93, "setup-client-with-remote-root"]], "Setup Client with System on Local Disk": [[93, "setup-client-with-system-on-local-disk"]], "Setup Client with System on Local MD RAID Disk": [[93, "setup-client-with-system-on-local-md-raid-disk"]], "Setup Loading of Custom Configuration File(s)": [[93, "setup-loading-of-custom-configuration-file-s"]], "Setup a Custom Boot Timeout": [[93, "setup-a-custom-boot-timeout"]], "Setup a Different Download Protocol and Server": [[93, "setup-a-different-download-protocol-and-server"]], "Setup custom kernel boot options": [[93, "setup-custom-kernel-boot-options"]], "Setup of the WSL-DistroLauncher": [[34, "setup-of-the-wsl-distrolauncher"]], "Sharing Backends": [[67, "sharing-backends"]], "Signing Git Patches": [[54, "signing-git-patches"]], "Specifying Disks and Disk Controllers": [[33, "specifying-disks-and-disk-controllers"]], "Submodules": [[1, "submodules"], [2, "submodules"], [4, "submodules"], [6, "submodules"], [7, "submodules"], [8, "submodules"], [9, "submodules"], [10, "submodules"], [11, "submodules"], [12, "submodules"], [13, "submodules"], [14, "submodules"], [15, "submodules"], [16, "submodules"], [17, "submodules"], [18, "submodules"], [19, "submodules"], [20, "submodules"], [21, "submodules"], [22, "submodules"], [23, "submodules"], [24, "submodules"], [25, "submodules"], [26, "submodules"]], "Supported repository paths": [[49, "supported-repository-paths"]], "System Requirements": [[64, "system-requirements"]], "Terminology": [[64, "terminology"]], "Test setup": [[58, "test-setup"]], "Testing the WSL image": [[34, "testing-the-wsl-image"]], "The Section": [[57, "the-extension-section"]], "The Appliance Concept": [[62, "the-appliance-concept"]], "The Basics": [[54, "the-basics"]], "The Create Step": [[45, "the-create-step"]], "The Prepare Step": [[45, "the-prepare-step"]], "The Runtime Configuration File": [[50, null]], "The archive element": [[47, "the-archive-element"]], "The ignore element": [[47, "the-ignore-element"]], "The package element": [[47, "the-package-element"]], "The product and namedCollection element": [[47, "the-product-and-namedcollection-element"]], "Troubleshooting": [[70, null]], "Turn a container into a VM image": [[68, "turn-a-container-into-a-vm-image"]], "Tweak and Customize your Image": [[69, "tweak-and-customize-your-image"]], "URI_TYPES": [[41, "uri-types"]], "Uninstall System Packages": [[47, "uninstall-system-packages"]], "Use Case": [[80, "use-case"]], "Use Cases": [[62, "use-cases"]], "User-Defined Scripts": [[51, null]], "Using KIWI NG in a Python Project": [[55, null]], "Using SUSE Product ISO To Build": [[98, null]], "Using the extension": [[57, "using-the-extension"]], "Working from the Command Line": [[35, null]], "Working with Images": [[76, null]], "Working with OBS": [[77, "working-with-obs"]], "Write Integration Tests for the Scripts": [[58, null]], "distro": [[71, null]], "dmsquash documentation": [[32, null]], "kiwi Package": [[1, null]], "kiwi-ng": [[38, null]], "kiwi-ng image info": [[36, null]], "kiwi-ng image resize": [[37, null]], "kiwi-ng result bundle": [[39, null]], "kiwi-ng result list": [[40, null]], "kiwi-ng system build": [[41, null]], "kiwi-ng system create": [[42, null]], "kiwi-ng system prepare": [[43, null]], "kiwi-ng system update": [[44, null]], "kiwi.app Module": [[1, "module-kiwi.app"]], "kiwi.archive Package": [[2, null]], "kiwi.archive.cpio Module": [[2, "module-kiwi.archive.cpio"]], "kiwi.archive.tar Module": [[2, "module-kiwi.archive.tar"]], "kiwi.boot Package": [[3, null]], "kiwi.boot.image Package": [[4, null]], "kiwi.boot.image.base Module": [[4, "module-kiwi.boot.image.base"]], "kiwi.boot.image.builtin_kiwi Module": [[4, "module-kiwi.boot.image.builtin_kiwi"]], "kiwi.boot.image.dracut Module": [[4, "module-kiwi.boot.image.dracut"]], "kiwi.bootloader Package": [[5, null]], "kiwi.bootloader.config Package": [[6, null]], "kiwi.bootloader.config.base Module": [[6, "module-kiwi.bootloader.config.base"]], "kiwi.bootloader.config.grub2 Module": [[6, "module-kiwi.bootloader.config.grub2"]], "kiwi.bootloader.config.systemd_boot Module": [[6, "module-kiwi.bootloader.config.systemd_boot"]], "kiwi.bootloader.config.zipl Module": [[6, "module-kiwi.bootloader.config.zipl"]], "kiwi.bootloader.install Package": [[7, null]], "kiwi.bootloader.install.base Module": [[7, "module-kiwi.bootloader.install.base"]], "kiwi.bootloader.install.grub2 Module": [[7, "module-kiwi.bootloader.install.grub2"]], "kiwi.bootloader.install.systemd_boot Module": [[7, "module-kiwi.bootloader.install.systemd_boot"]], "kiwi.bootloader.install.zipl Module": [[7, "module-kiwi.bootloader.install.zipl"]], "kiwi.bootloader.template Package": [[8, null]], "kiwi.bootloader.template.grub2 Module": [[8, "module-kiwi.bootloader.template.grub2"]], "kiwi.builder Package": [[9, null]], "kiwi.builder.archive Module": [[9, "module-kiwi.builder.archive"]], "kiwi.builder.container Module": [[9, "module-kiwi.builder.container"]], "kiwi.builder.disk Module": [[9, "module-kiwi.builder.disk"]], "kiwi.builder.filesystem Module": [[9, "module-kiwi.builder.filesystem"]], "kiwi.builder.install Module": [[9, "module-kiwi.builder.install"]], "kiwi.builder.kis Module": [[9, "module-kiwi.builder.kis"]], "kiwi.builder.live Module": [[9, "module-kiwi.builder.live"]], "kiwi.cli Module": [[1, "module-kiwi.cli"]], "kiwi.command Module": [[1, "module-kiwi.command"]], "kiwi.command_process Module": [[1, "module-kiwi.command_process"]], "kiwi.container Package": [[10, null]], "kiwi.container.oci Module": [[10, "module-kiwi.container.oci"]], "kiwi.container.setup Package": [[11, null]], "kiwi.container.setup.base Module": [[11, "module-kiwi.container.setup.base"]], "kiwi.container.setup.docker Module": [[11, "module-kiwi.container.setup.docker"]], "kiwi.defaults Module": [[1, "module-kiwi.defaults"]], "kiwi.exceptions Module": [[1, "module-kiwi.exceptions"]], "kiwi.filesystem Package": [[12, null]], "kiwi.filesystem.base Module": [[12, "module-kiwi.filesystem.base"]], "kiwi.filesystem.btrfs Module": [[12, "module-kiwi.filesystem.btrfs"]], "kiwi.filesystem.ext2 Module": [[12, "module-kiwi.filesystem.ext2"]], "kiwi.filesystem.ext3 Module": [[12, "module-kiwi.filesystem.ext3"]], "kiwi.filesystem.ext4 Module": [[12, "module-kiwi.filesystem.ext4"]], "kiwi.filesystem.fat16 Module": [[12, "module-kiwi.filesystem.fat16"]], "kiwi.filesystem.fat32 Module": [[12, "module-kiwi.filesystem.fat32"]], "kiwi.filesystem.isofs Module": [[12, "module-kiwi.filesystem.isofs"]], "kiwi.filesystem.setup Module": [[12, "module-kiwi.filesystem.setup"]], "kiwi.filesystem.squashfs Module": [[12, "module-kiwi.filesystem.squashfs"]], "kiwi.filesystem.xfs Module": [[12, "module-kiwi.filesystem.xfs"]], "kiwi.firmware Module": [[1, "module-kiwi.firmware"]], "kiwi.help Module": [[1, "module-kiwi.help"]], "kiwi.iso_tools Package": [[13, null]], "kiwi.iso_tools.base Module": [[13, "module-kiwi.iso_tools.base"]], "kiwi.iso_tools.iso Module": [[13, "module-kiwi.iso_tools.iso"]], "kiwi.iso_tools.xorriso Module": [[13, "module-kiwi.iso_tools.xorriso"]], "kiwi.kiwi Module": [[1, "module-kiwi.kiwi"]], "kiwi.logger Module": [[1, "module-kiwi.logger"]], "kiwi.logger_color_formatter Module": [[1, "module-kiwi.logger_color_formatter"]], "kiwi.logger_filter Module": [[1, "module-kiwi.logger_filter"]], "kiwi.mount_manager Module": [[1, "module-kiwi.mount_manager"]], "kiwi.package_manager Package": [[14, null]], "kiwi.package_manager.base Module": [[14, "module-kiwi.package_manager.base"]], "kiwi.package_manager.dnf4 Module": [[14, "module-kiwi.package_manager.dnf4"]], "kiwi.package_manager.zypper Module": [[14, "module-kiwi.package_manager.zypper"]], "kiwi.partitioner Package": [[15, null]], "kiwi.partitioner.base Module": [[15, "module-kiwi.partitioner.base"]], "kiwi.partitioner.dasd Module": [[15, "module-kiwi.partitioner.dasd"]], "kiwi.partitioner.gpt Module": [[15, "module-kiwi.partitioner.gpt"]], "kiwi.partitioner.msdos Module": [[15, "module-kiwi.partitioner.msdos"]], "kiwi.path Module": [[1, "module-kiwi.path"]], "kiwi.privileges Module": [[1, "module-kiwi.privileges"]], "kiwi.repository Package": [[16, null]], "kiwi.repository.base Module": [[16, "module-kiwi.repository.base"]], "kiwi.repository.dnf4 Module": [[16, "module-kiwi.repository.dnf4"]], "kiwi.repository.template Package": [[17, null]], "kiwi.repository.template.apt Module": [[17, "module-kiwi.repository.template.apt"]], "kiwi.repository.zypper Module": [[16, "module-kiwi.repository.zypper"]], "kiwi.runtime_checker Module": [[1, "module-kiwi.runtime_checker"]], "kiwi.runtime_config Module": [[1, "module-kiwi.runtime_config"]], "kiwi.solver Package": [[18, null]], "kiwi.solver.repository Package": [[19, null]], "kiwi.solver.repository.base Module": [[19, "module-kiwi.solver.repository.base"]], "kiwi.solver.sat Module": [[18, "module-kiwi.solver.sat"]], "kiwi.storage Package": [[20, null]], "kiwi.storage.clone_device Module": [[20, "module-kiwi.storage.clone_device"]], "kiwi.storage.device_provider Module": [[20, "module-kiwi.storage.device_provider"]], "kiwi.storage.disk Module": [[20, "module-kiwi.storage.disk"]], "kiwi.storage.loop_device Module": [[20, "module-kiwi.storage.loop_device"]], "kiwi.storage.luks_device Module": [[20, "module-kiwi.storage.luks_device"]], "kiwi.storage.mapped_device Module": [[20, "module-kiwi.storage.mapped_device"]], "kiwi.storage.raid_device Module": [[20, "module-kiwi.storage.raid_device"]], "kiwi.storage.setup Module": [[20, "module-kiwi.storage.setup"]], "kiwi.storage.subformat Package": [[21, null]], "kiwi.storage.subformat.base Module": [[21, "module-kiwi.storage.subformat.base"]], "kiwi.storage.subformat.gce Module": [[21, "module-kiwi.storage.subformat.gce"]], "kiwi.storage.subformat.ova Module": [[21, "module-kiwi.storage.subformat.ova"]], "kiwi.storage.subformat.qcow2 Module": [[21, "module-kiwi.storage.subformat.qcow2"]], "kiwi.storage.subformat.template Package": [[22, null]], "kiwi.storage.subformat.template.vagrant_config Module": [[22, "module-kiwi.storage.subformat.template.vagrant_config"]], "kiwi.storage.subformat.template.virtualbox_ovf Module": [[22, "module-kiwi.storage.subformat.template.virtualbox_ovf"]], "kiwi.storage.subformat.template.vmware_settings Module": [[22, "module-kiwi.storage.subformat.template.vmware_settings"]], "kiwi.storage.subformat.vagrant_base Module": [[21, "module-kiwi.storage.subformat.vagrant_base"]], "kiwi.storage.subformat.vagrant_libvirt Module": [[21, "module-kiwi.storage.subformat.vagrant_libvirt"]], "kiwi.storage.subformat.vagrant_virtualbox Module": [[21, "module-kiwi.storage.subformat.vagrant_virtualbox"]], "kiwi.storage.subformat.vdi Module": [[21, "module-kiwi.storage.subformat.vdi"]], "kiwi.storage.subformat.vhd Module": [[21, "module-kiwi.storage.subformat.vhd"]], "kiwi.storage.subformat.vhdfixed Module": [[21, "module-kiwi.storage.subformat.vhdfixed"]], "kiwi.storage.subformat.vhdx Module": [[21, "module-kiwi.storage.subformat.vhdx"]], "kiwi.storage.subformat.vmdk Module": [[21, "module-kiwi.storage.subformat.vmdk"]], "kiwi.system Package": [[23, null]], "kiwi.system.identifier Module": [[23, "module-kiwi.system.identifier"]], "kiwi.system.kernel Module": [[23, "module-kiwi.system.kernel"]], "kiwi.system.prepare Module": [[23, "module-kiwi.system.prepare"]], "kiwi.system.profile Module": [[23, "module-kiwi.system.profile"]], "kiwi.system.result Module": [[23, "module-kiwi.system.result"]], "kiwi.system.root_bind Module": [[23, "module-kiwi.system.root_bind"]], "kiwi.system.root_init Module": [[23, "module-kiwi.system.root_init"]], "kiwi.system.setup Module": [[23, "module-kiwi.system.setup"]], "kiwi.system.shell Module": [[23, "module-kiwi.system.shell"]], "kiwi.system.size Module": [[23, "module-kiwi.system.size"]], "kiwi.system.uri Module": [[23, "module-kiwi.system.uri"]], "kiwi.system.users Module": [[23, "module-kiwi.system.users"]], "kiwi.tasks package": [[24, null]], "kiwi.tasks.base Module": [[24, "module-kiwi.tasks.base"]], "kiwi.tasks.result_bundle Module": [[24, "module-kiwi.tasks.result_bundle"]], "kiwi.tasks.result_list Module": [[24, "module-kiwi.tasks.result_list"]], "kiwi.tasks.system_build Module": [[24, "module-kiwi.tasks.system_build"]], "kiwi.tasks.system_create Module": [[24, "module-kiwi.tasks.system_create"]], "kiwi.tasks.system_prepare Module": [[24, "module-kiwi.tasks.system_prepare"]], "kiwi.tasks.system_update Module": [[24, "module-kiwi.tasks.system_update"]], "kiwi.utils Package": [[25, null]], "kiwi.utils.block Module": [[25, "module-kiwi.utils.checksum"]], "kiwi.utils.checksum Module": [[25, "module-kiwi.utils.block"]], "kiwi.utils.compress Module": [[25, "module-kiwi.utils.compress"]], "kiwi.utils.sync Module": [[25, "module-kiwi.utils.sync"]], "kiwi.utils.sysconfig Module": [[25, "module-kiwi.utils.sysconfig"]], "kiwi.version Module": [[1, "module-kiwi.version"]], "kiwi.volume_manager Package": [[26, null]], "kiwi.volume_manager.base Module": [[26, "module-kiwi.volume_manager.base"]], "kiwi.volume_manager.btrfs Module": [[26, "module-kiwi.volume_manager.btrfs"]], "kiwi.volume_manager.lvm Module": [[26, "module-kiwi.volume_manager.lvm"]], "kiwi.xml_description Module": [[1, "module-kiwi.xml_description"]], "kiwi.xml_state Module": [[1, "module-kiwi.xml_state"]], "overlay or dmsquash": [[32, "overlay-or-dmsquash"]]}, "docnames": ["api", "api/kiwi", "api/kiwi.archive", "api/kiwi.boot", "api/kiwi.boot.image", "api/kiwi.bootloader", "api/kiwi.bootloader.config", "api/kiwi.bootloader.install", "api/kiwi.bootloader.template", "api/kiwi.builder", "api/kiwi.container", "api/kiwi.container.setup", "api/kiwi.filesystem", "api/kiwi.iso_tools", "api/kiwi.package_manager", "api/kiwi.partitioner", "api/kiwi.repository", "api/kiwi.repository.template", "api/kiwi.solver", "api/kiwi.solver.repository", "api/kiwi.storage", "api/kiwi.storage.subformat", "api/kiwi.storage.subformat.template", "api/kiwi.system", "api/kiwi.tasks", "api/kiwi.utils", "api/kiwi.volume_manager", "building_images", "building_images/build_container_image", "building_images/build_enclave", "building_images/build_expandable_disk", "building_images/build_kis", "building_images/build_live_iso", "building_images/build_simple_disk", "building_images/build_wsl_container", "commands", "commands/image_info", "commands/image_resize", "commands/kiwi", "commands/result_bundle", "commands/result_list", "commands/system_build", "commands/system_create", "commands/system_prepare", "commands/system_update", "concept_and_workflow", "concept_and_workflow/customize_the_boot_process", "concept_and_workflow/packages", "concept_and_workflow/profiles", "concept_and_workflow/repository_setup", "concept_and_workflow/runtime_configuration", "concept_and_workflow/shell_scripts", "concept_and_workflow/systemdeps", "concept_and_workflow/users", "contributing", "contributing/kiwi_from_python", "contributing/kiwi_plugin_architecture", "contributing/schema_extensions", "contributing/scripts_testing", "image_description", "image_description/elements", "image_types_and_results", "index", "installation", "overview", "overview/workflow", "plugins", "plugins/self_contained", "plugins/stackbuild", "quickstart", "troubleshooting", "troubleshooting/architectures", "troubleshooting/boxbuild_tweaks", "troubleshooting/buildhost_constraints", "troubleshooting/filesystems", "troubleshooting/security", "working_with_images", "working_with_images/build_in_buildservice", "working_with_images/build_with_profiles", "working_with_images/build_without_debianbootstrap", "working_with_images/clone_partitions", "working_with_images/custom_fstab_extension", "working_with_images/custom_partitions", "working_with_images/custom_volumes", "working_with_images/disk_ramdisk_deployment", "working_with_images/disk_setup_for_azure", "working_with_images/disk_setup_for_ec2", "working_with_images/disk_setup_for_google", "working_with_images/disk_setup_for_luks", "working_with_images/disk_setup_for_vagrant", "working_with_images/iso_to_usb_stick_deployment", "working_with_images/iso_to_usb_stick_file_based_deployment", "working_with_images/iso_to_usb_stick_grub2_boot_from_iso", "working_with_images/legacy_netboot_root_filesystem", "working_with_images/network_live_iso_boot", "working_with_images/network_overlay_boot", "working_with_images/setup_network_bootserver", "working_with_images/setup_yast_on_first_boot", "working_with_images/use_suse_media"], "envversion": {"sphinx": 62, "sphinx.domains.c": 3, "sphinx.domains.changeset": 1, "sphinx.domains.citation": 1, "sphinx.domains.cpp": 9, "sphinx.domains.index": 1, "sphinx.domains.javascript": 3, "sphinx.domains.math": 2, "sphinx.domains.python": 4, "sphinx.domains.rst": 2, "sphinx.domains.std": 2, "sphinx.ext.todo": 2, "sphinx.ext.viewcode": 1}, "filenames": ["api.rst", "api/kiwi.rst", "api/kiwi.archive.rst", "api/kiwi.boot.rst", "api/kiwi.boot.image.rst", "api/kiwi.bootloader.rst", "api/kiwi.bootloader.config.rst", "api/kiwi.bootloader.install.rst", "api/kiwi.bootloader.template.rst", "api/kiwi.builder.rst", "api/kiwi.container.rst", "api/kiwi.container.setup.rst", "api/kiwi.filesystem.rst", "api/kiwi.iso_tools.rst", "api/kiwi.package_manager.rst", "api/kiwi.partitioner.rst", "api/kiwi.repository.rst", "api/kiwi.repository.template.rst", "api/kiwi.solver.rst", "api/kiwi.solver.repository.rst", "api/kiwi.storage.rst", "api/kiwi.storage.subformat.rst", "api/kiwi.storage.subformat.template.rst", "api/kiwi.system.rst", "api/kiwi.tasks.rst", "api/kiwi.utils.rst", "api/kiwi.volume_manager.rst", "building_images.rst", "building_images/build_container_image.rst", "building_images/build_enclave.rst", "building_images/build_expandable_disk.rst", "building_images/build_kis.rst", "building_images/build_live_iso.rst", "building_images/build_simple_disk.rst", "building_images/build_wsl_container.rst", "commands.rst", "commands/image_info.rst", "commands/image_resize.rst", "commands/kiwi.rst", "commands/result_bundle.rst", "commands/result_list.rst", "commands/system_build.rst", "commands/system_create.rst", "commands/system_prepare.rst", "commands/system_update.rst", "concept_and_workflow.rst", "concept_and_workflow/customize_the_boot_process.rst", "concept_and_workflow/packages.rst", "concept_and_workflow/profiles.rst", "concept_and_workflow/repository_setup.rst", "concept_and_workflow/runtime_configuration.rst", "concept_and_workflow/shell_scripts.rst", "concept_and_workflow/systemdeps.rst", "concept_and_workflow/users.rst", "contributing.rst", "contributing/kiwi_from_python.rst", "contributing/kiwi_plugin_architecture.rst", "contributing/schema_extensions.rst", "contributing/scripts_testing.rst", "image_description.rst", "image_description/elements.rst", "image_types_and_results.rst", "index.rst", "installation.rst", "overview.rst", "overview/workflow.rst", "plugins.rst", "plugins/self_contained.rst", "plugins/stackbuild.rst", "quickstart.rst", "troubleshooting.rst", "troubleshooting/architectures.rst", "troubleshooting/boxbuild_tweaks.rst", "troubleshooting/buildhost_constraints.rst", "troubleshooting/filesystems.rst", "troubleshooting/security.rst", "working_with_images.rst", "working_with_images/build_in_buildservice.rst", "working_with_images/build_with_profiles.rst", "working_with_images/build_without_debianbootstrap.rst", "working_with_images/clone_partitions.rst", "working_with_images/custom_fstab_extension.rst", "working_with_images/custom_partitions.rst", "working_with_images/custom_volumes.rst", "working_with_images/disk_ramdisk_deployment.rst", "working_with_images/disk_setup_for_azure.rst", "working_with_images/disk_setup_for_ec2.rst", "working_with_images/disk_setup_for_google.rst", "working_with_images/disk_setup_for_luks.rst", "working_with_images/disk_setup_for_vagrant.rst", "working_with_images/iso_to_usb_stick_deployment.rst", "working_with_images/iso_to_usb_stick_file_based_deployment.rst", "working_with_images/iso_to_usb_stick_grub2_boot_from_iso.rst", "working_with_images/legacy_netboot_root_filesystem.rst", "working_with_images/network_live_iso_boot.rst", "working_with_images/network_overlay_boot.rst", "working_with_images/setup_network_bootserver.rst", "working_with_images/setup_yast_on_first_boot.rst", "working_with_images/use_suse_media.rst"], "indexentries": {"a (kiwi.system.result.result_name_tags attribute)": [[23, "kiwi.system.result.result_name_tags.A", false]], "access() (kiwi.path.path static method)": [[1, "kiwi.path.Path.access", false]], "accumulate_files() (kiwi.system.size.systemsize method)": [[23, "kiwi.system.size.SystemSize.accumulate_files", false]], "accumulate_mbyte_file_sizes() (kiwi.system.size.systemsize method)": [[23, "kiwi.system.size.SystemSize.accumulate_mbyte_file_sizes", false]], "activate_boot_partition() (kiwi.storage.disk.disk method)": [[20, "kiwi.storage.disk.Disk.activate_boot_partition", false]], "add() (kiwi.system.profile.profile method)": [[23, "kiwi.system.profile.Profile.add", false]], "add() (kiwi.system.result.result method)": [[23, "kiwi.system.result.Result.add", false]], "add_bundle_format() (kiwi.system.result.result method)": [[23, "kiwi.system.result.Result.add_bundle_format", false]], "add_container_config_label() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.add_container_config_label", false]], "add_efi_loader_parameters() (kiwi.iso_tools.base.isotoolsbase method)": [[13, "kiwi.iso_tools.base.IsoToolsBase.add_efi_loader_parameters", false]], "add_efi_loader_parameters() (kiwi.iso_tools.xorriso.isotoolsxorriso method)": [[13, "kiwi.iso_tools.xorriso.IsoToolsXorrIso.add_efi_loader_parameters", false]], "add_repo() (kiwi.repository.base.repositorybase method)": [[16, "kiwi.repository.base.RepositoryBase.add_repo", false]], "add_repo() (kiwi.repository.dnf4.repositorydnf4 method)": [[16, "kiwi.repository.dnf4.RepositoryDnf4.add_repo", false]], "add_repo() (kiwi.repository.zypper.repositoryzypper method)": [[16, "kiwi.repository.zypper.RepositoryZypper.add_repo", false]], "add_repository() (kiwi.solver.sat.sat method)": [[18, "kiwi.solver.sat.Sat.add_repository", false]], "add_repository() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.add_repository", false]], "additional_names (kiwi.container.oci.ociconfig attribute)": [[10, "kiwi.container.oci.OciConfig.additional_names", false]], "additive (kiwi.xml_state.size_type attribute)": [[1, "kiwi.xml_state.size_type.additive", false]], "alias() (kiwi.system.uri.uri method)": [[23, "kiwi.system.uri.Uri.alias", false]], "app (class in kiwi.app)": [[1, "kiwi.app.App", false]], "append_files() (kiwi.archive.tar.archivetar method)": [[2, "kiwi.archive.tar.ArchiveTar.append_files", false]], "append_unpartitioned_space() (kiwi.builder.disk.diskbuilder method)": [[9, "kiwi.builder.disk.DiskBuilder.append_unpartitioned_space", false]], "apply_attributes_on_volume() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.apply_attributes_on_volume", false]], "archivebuilder (class in kiwi.builder.archive)": [[9, "kiwi.builder.archive.ArchiveBuilder", false]], "archivecpio (class in kiwi.archive.cpio)": [[2, "kiwi.archive.cpio.ArchiveCpio", false]], "archivetar (class in kiwi.archive.tar)": [[2, "kiwi.archive.tar.ArchiveTar", false]], "attr_token() (kiwi.tasks.base.clitask method)": [[24, "kiwi.tasks.base.CliTask.attr_token", false]], "attributes (kiwi.xml_state.volume_type attribute)": [[1, "kiwi.xml_state.volume_type.attributes", false]], "author (kiwi.xml_state.description_type attribute)": [[1, "kiwi.xml_state.description_type.author", false]], "backend (kiwi.xml_state.containert attribute)": [[1, "kiwi.xml_state.ContainerT.backend", false]], "binaryname (kiwi.defaults.grub_loader_type attribute)": [[1, "kiwi.defaults.grub_loader_type.binaryname", false]], "binaryname (kiwi.defaults.shim_loader_type attribute)": [[1, "kiwi.defaults.shim_loader_type.binaryname", false]], "bind_mount() (kiwi.mount_manager.mountmanager method)": [[1, "kiwi.mount_manager.MountManager.bind_mount", false]], "bios_mode() (kiwi.firmware.firmware method)": [[1, "kiwi.firmware.FirmWare.bios_mode", false]], "blockid (class in kiwi.utils.block)": [[25, "kiwi.utils.block.BlockID", false]], "boot_names_type (class in kiwi.boot.image.base)": [[4, "kiwi.boot.image.base.boot_names_type", false]], "boot_partition_size() (kiwi.storage.setup.disksetup method)": [[20, "kiwi.storage.setup.DiskSetup.boot_partition_size", false]], "bootimage (class in kiwi.boot.image)": [[4, "kiwi.boot.image.BootImage", false]], "bootimagebase (class in kiwi.boot.image.base)": [[4, "kiwi.boot.image.base.BootImageBase", false]], "bootimagedracut (class in kiwi.boot.image.dracut)": [[4, "kiwi.boot.image.dracut.BootImageDracut", false]], "bootimagekiwi (class in kiwi.boot.image.builtin_kiwi)": [[4, "kiwi.boot.image.builtin_kiwi.BootImageKiwi", false]], "bootloaderconfigbase (class in kiwi.bootloader.config.base)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase", false]], "bootloaderconfiggrub2 (class in kiwi.bootloader.config.grub2)": [[6, "kiwi.bootloader.config.grub2.BootLoaderConfigGrub2", false]], "bootloaderinstall (class in kiwi.bootloader.install)": [[7, "kiwi.bootloader.install.BootLoaderInstall", false]], "bootloaderinstallbase (class in kiwi.bootloader.install.base)": [[7, "kiwi.bootloader.install.base.BootLoaderInstallBase", false]], "bootloaderinstallgrub2 (class in kiwi.bootloader.install.grub2)": [[7, "kiwi.bootloader.install.grub2.BootLoaderInstallGrub2", false]], "bootloaderinstallsystemdboot (class in kiwi.bootloader.install.systemd_boot)": [[7, "kiwi.bootloader.install.systemd_boot.BootLoaderInstallSystemdBoot", false]], "bootloaderinstallzipl (class in kiwi.bootloader.install.zipl)": [[7, "kiwi.bootloader.install.zipl.BootLoaderInstallZipl", false]], "bootloadersystemdboot (class in kiwi.bootloader.config.systemd_boot)": [[6, "kiwi.bootloader.config.systemd_boot.BootLoaderSystemdBoot", false]], "bootloadertemplategrub2 (class in kiwi.bootloader.template.grub2)": [[8, "kiwi.bootloader.template.grub2.BootLoaderTemplateGrub2", false]], "bootloaderzipl (class in kiwi.bootloader.config.zipl)": [[6, "kiwi.bootloader.config.zipl.BootLoaderZipl", false]], "btrfs_default_volume_requested() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.btrfs_default_volume_requested", false]], "byte (kiwi.defaults.unit_type attribute)": [[1, "kiwi.defaults.unit_type.byte", false]], "calculate_id() (kiwi.system.identifier.systemidentifier method)": [[23, "kiwi.system.identifier.SystemIdentifier.calculate_id", false]], "call() (kiwi.command.command static method)": [[1, "kiwi.command.Command.call", false]], "call_config_host_overlay_script() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.call_config_host_overlay_script", false]], "call_config_overlay_script() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.call_config_overlay_script", false]], "call_config_script() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.call_config_script", false]], "call_disk_script() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.call_disk_script", false]], "call_edit_boot_config_script() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.call_edit_boot_config_script", false]], "call_edit_boot_install_script() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.call_edit_boot_install_script", false]], "call_image_script() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.call_image_script", false]], "call_post_bootstrap_script() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.call_post_bootstrap_script", false]], "call_pre_disk_script() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.call_pre_disk_script", false]], "check_appx_naming_conventions_valid() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_appx_naming_conventions_valid", false]], "check_boot_description_exists() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_boot_description_exists", false]], "check_consistent_kernel_in_boot_and_system_image() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_consistent_kernel_in_boot_and_system_image", false]], "check_container_tool_chain_installed() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_container_tool_chain_installed", false]], "check_dracut_module_for_disk_oem_in_package_list() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_dracut_module_for_disk_oem_in_package_list", false]], "check_dracut_module_for_disk_overlay_in_package_list() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_dracut_module_for_disk_overlay_in_package_list", false]], "check_dracut_module_for_live_iso_in_package_list() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_dracut_module_for_live_iso_in_package_list", false]], "check_dracut_module_for_oem_install_in_package_list() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_dracut_module_for_oem_install_in_package_list", false]], "check_dracut_module_versions_compatible_to_kiwi() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_dracut_module_versions_compatible_to_kiwi", false]], "check_efi_fat_image_has_correct_size() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_efi_fat_image_has_correct_size", false]], "check_efi_mode_for_disk_overlay_correctly_setup() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_efi_mode_for_disk_overlay_correctly_setup", false]], "check_for_root_permissions() (kiwi.privileges.privileges static method)": [[1, "kiwi.privileges.Privileges.check_for_root_permissions", false]], "check_image_include_repos_publicly_resolvable() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_image_include_repos_publicly_resolvable", false]], "check_image_type_unique() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_image_type_unique", false]], "check_image_version_provided() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_image_version_provided", false]], "check_include_references_unresolvable() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_include_references_unresolvable", false]], "check_initrd_selection_required() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_initrd_selection_required", false]], "check_luksformat_options_valid() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_luksformat_options_valid", false]], "check_mediacheck_installed() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_mediacheck_installed", false]], "check_partuuid_persistency_type_used_with_mbr() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_partuuid_persistency_type_used_with_mbr", false]], "check_repositories_configured() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_repositories_configured", false]], "check_swap_name_used_with_lvm() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_swap_name_used_with_lvm", false]], "check_target_directory_not_in_shared_cache() (kiwi.runtime_checker.runtimechecker static method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_target_directory_not_in_shared_cache", false]], "check_volume_label_used_with_lvm() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_volume_label_used_with_lvm", false]], "check_volume_setup_defines_multiple_fullsize_volumes() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_volume_setup_defines_multiple_fullsize_volumes", false]], "check_volume_setup_defines_reserved_labels() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_volume_setup_defines_reserved_labels", false]], "check_volume_setup_has_no_root_definition() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_volume_setup_has_no_root_definition", false]], "check_xen_uniquely_setup_as_server_or_guest() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_xen_uniquely_setup_as_server_or_guest", false]], "checksum (class in kiwi.utils.checksum)": [[25, "kiwi.utils.checksum.Checksum", false]], "clean_leftovers() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.clean_leftovers", false]], "clean_leftovers() (kiwi.package_manager.dnf4.packagemanagerdnf4 method)": [[14, "kiwi.package_manager.dnf4.PackageManagerDnf4.clean_leftovers", false]], "clean_leftovers() (kiwi.package_manager.zypper.packagemanagerzypper method)": [[14, "kiwi.package_manager.zypper.PackageManagerZypper.clean_leftovers", false]], "clean_package_manager_leftovers() (kiwi.system.prepare.systemprepare method)": [[23, "kiwi.system.prepare.SystemPrepare.clean_package_manager_leftovers", false]], "cleanup() (kiwi.boot.image.base.bootimagebase method)": [[4, "kiwi.boot.image.base.BootImageBase.cleanup", false]], "cleanup() (kiwi.boot.image.builtin_kiwi.bootimagekiwi method)": [[4, "kiwi.boot.image.builtin_kiwi.BootImageKiwi.cleanup", false]], "cleanup() (kiwi.repository.base.repositorybase method)": [[16, "kiwi.repository.base.RepositoryBase.cleanup", false]], "cleanup() (kiwi.repository.dnf4.repositorydnf4 method)": [[16, "kiwi.repository.dnf4.RepositoryDnf4.cleanup", false]], "cleanup() (kiwi.repository.zypper.repositoryzypper method)": [[16, "kiwi.repository.zypper.RepositoryZypper.cleanup", false]], "cleanup() (kiwi.system.root_bind.rootbind method)": [[23, "kiwi.system.root_bind.RootBind.cleanup", false]], "cleanup() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.cleanup", false]], "cleanup_requests() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.cleanup_requests", false]], "cleanup_unused_repos() (kiwi.repository.base.repositorybase method)": [[16, "kiwi.repository.base.RepositoryBase.cleanup_unused_repos", false]], "cleanup_unused_repos() (kiwi.repository.dnf4.repositorydnf4 method)": [[16, "kiwi.repository.dnf4.RepositoryDnf4.cleanup_unused_repos", false]], "cleanup_unused_repos() (kiwi.repository.zypper.repositoryzypper method)": [[16, "kiwi.repository.zypper.RepositoryZypper.cleanup_unused_repos", false]], "cli (class in kiwi.cli)": [[1, "kiwi.cli.Cli", false]], "clitask (class in kiwi.tasks.base)": [[24, "kiwi.tasks.base.CliTask", false]], "clone (kiwi.storage.disk.ptable_entry_type attribute)": [[20, "kiwi.storage.disk.ptable_entry_type.clone", false]], "clone() (kiwi.storage.clone_device.clonedevice method)": [[20, "kiwi.storage.clone_device.CloneDevice.clone", false]], "clonedevice (class in kiwi.storage.clone_device)": [[20, "kiwi.storage.clone_device.CloneDevice", false]], "collection_matches_host_architecture() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.collection_matches_host_architecture", false]], "colorformatter (class in kiwi.logger_color_formatter)": [[1, "kiwi.logger_color_formatter.ColorFormatter", false]], "colormessage (class in kiwi.logger_color_formatter)": [[1, "kiwi.logger_color_formatter.ColorMessage", false]], "command (class in kiwi.command)": [[1, "kiwi.command.Command", false]], "commandcallt (class in kiwi.command)": [[1, "kiwi.command.CommandCallT", false]], "commanditerator (class in kiwi.command_process)": [[1, "kiwi.command_process.CommandIterator", false]], "commandprocess (class in kiwi.command_process)": [[1, "kiwi.command_process.CommandProcess", false]], "commandt (class in kiwi.command)": [[1, "kiwi.command.CommandT", false]], "compress (class in kiwi.utils.compress)": [[25, "kiwi.utils.compress.Compress", false]], "compress (kiwi.system.result.result_file_type attribute)": [[23, "kiwi.system.result.result_file_type.compress", false]], "contact (kiwi.xml_state.description_type attribute)": [[1, "kiwi.xml_state.description_type.contact", false]], "container_file (kiwi.xml_state.containert attribute)": [[1, "kiwi.xml_state.ContainerT.container_file", false]], "container_matches_host_architecture() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.container_matches_host_architecture", false]], "container_name (kiwi.container.oci.ociconfig attribute)": [[10, "kiwi.container.oci.OciConfig.container_name", false]], "container_tag (kiwi.container.oci.ociconfig attribute)": [[10, "kiwi.container.oci.OciConfig.container_tag", false]], "containerbuilder (class in kiwi.builder.container)": [[9, "kiwi.builder.container.ContainerBuilder", false]], "containerimage (class in kiwi.container)": [[10, "kiwi.container.ContainerImage", false]], "containerimageoci (class in kiwi.container.oci)": [[10, "kiwi.container.oci.ContainerImageOCI", false]], "containers_matches_host_architecture() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.containers_matches_host_architecture", false]], "containersetup (class in kiwi.container.setup)": [[11, "kiwi.container.setup.ContainerSetup", false]], "containersetupbase (class in kiwi.container.setup.base)": [[11, "kiwi.container.setup.base.ContainerSetupBase", false]], "containersetupdocker (class in kiwi.container.setup.docker)": [[11, "kiwi.container.setup.docker.ContainerSetupDocker", false]], "containert (class in kiwi.xml_state)": [[1, "kiwi.xml_state.ContainerT", false]], "copy_bootdelete_packages() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.copy_bootdelete_packages", false]], "copy_bootincluded_archives() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.copy_bootincluded_archives", false]], "copy_bootincluded_packages() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.copy_bootincluded_packages", false]], "copy_bootloader_section() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.copy_bootloader_section", false]], "copy_build_type_attributes() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.copy_build_type_attributes", false]], "copy_displayname() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.copy_displayname", false]], "copy_drivers_sections() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.copy_drivers_sections", false]], "copy_kernel() (kiwi.system.kernel.kernel method)": [[23, "kiwi.system.kernel.Kernel.copy_kernel", false]], "copy_machine_section() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.copy_machine_section", false]], "copy_name() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.copy_name", false]], "copy_oemconfig_section() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.copy_oemconfig_section", false]], "copy_preferences_subsections() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.copy_preferences_subsections", false]], "copy_repository_sections() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.copy_repository_sections", false]], "copy_strip_sections() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.copy_strip_sections", false]], "copy_systemdisk_section() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.copy_systemdisk_section", false]], "copy_xen_hypervisor() (kiwi.system.kernel.kernel method)": [[23, "kiwi.system.kernel.Kernel.copy_xen_hypervisor", false]], "create() (kiwi.archive.cpio.archivecpio method)": [[2, "kiwi.archive.cpio.ArchiveCpio.create", false]], "create() (kiwi.archive.tar.archivetar method)": [[2, "kiwi.archive.tar.ArchiveTar.create", false]], "create() (kiwi.builder.archive.archivebuilder method)": [[9, "kiwi.builder.archive.ArchiveBuilder.create", false]], "create() (kiwi.builder.container.containerbuilder method)": [[9, "kiwi.builder.container.ContainerBuilder.create", false]], "create() (kiwi.builder.disk.diskbuilder method)": [[9, "kiwi.builder.disk.DiskBuilder.create", false]], "create() (kiwi.builder.filesystem.filesystembuilder method)": [[9, "kiwi.builder.filesystem.FileSystemBuilder.create", false]], "create() (kiwi.builder.kis.kisbuilder method)": [[9, "kiwi.builder.kis.KisBuilder.create", false]], "create() (kiwi.builder.live.liveimagebuilder method)": [[9, "kiwi.builder.live.LiveImageBuilder.create", false]], "create() (kiwi.container.oci.containerimageoci method)": [[10, "kiwi.container.oci.ContainerImageOCI.create", false]], "create() (kiwi.partitioner.base.partitionerbase method)": [[15, "kiwi.partitioner.base.PartitionerBase.create", false]], "create() (kiwi.partitioner.dasd.partitionerdasd method)": [[15, "kiwi.partitioner.dasd.PartitionerDasd.create", false]], "create() (kiwi.partitioner.gpt.partitionergpt method)": [[15, "kiwi.partitioner.gpt.PartitionerGpt.create", false]], "create() (kiwi.partitioner.msdos.partitionermsdos method)": [[15, "kiwi.partitioner.msdos.PartitionerMsDos.create", false]], "create() (kiwi.path.path static method)": [[1, "kiwi.path.Path.create", false]], "create() (kiwi.storage.loop_device.loopdevice method)": [[20, "kiwi.storage.loop_device.LoopDevice.create", false]], "create() (kiwi.system.profile.profile method)": [[23, "kiwi.system.profile.Profile.create", false]], "create() (kiwi.system.root_init.rootinit method)": [[23, "kiwi.system.root_init.RootInit.create", false]], "create_boot_loader_config() (in module kiwi.bootloader.config)": [[6, "kiwi.bootloader.config.create_boot_loader_config", false]], "create_boot_partition() (kiwi.storage.disk.disk method)": [[20, "kiwi.storage.disk.Disk.create_boot_partition", false]], "create_box_img() (kiwi.storage.subformat.vagrant_base.diskformatvagrantbase method)": [[21, "kiwi.storage.subformat.vagrant_base.DiskFormatVagrantBase.create_box_img", false]], "create_box_img() (kiwi.storage.subformat.vagrant_libvirt.diskformatvagrantlibvirt method)": [[21, "kiwi.storage.subformat.vagrant_libvirt.DiskFormatVagrantLibVirt.create_box_img", false]], "create_box_img() (kiwi.storage.subformat.vagrant_virtualbox.diskformatvagrantvirtualbox method)": [[21, "kiwi.storage.subformat.vagrant_virtualbox.DiskFormatVagrantVirtualBox.create_box_img", false]], "create_crypto_luks() (kiwi.storage.luks_device.luksdevice method)": [[20, "kiwi.storage.luks_device.LuksDevice.create_crypto_luks", false]], "create_crypttab() (kiwi.storage.luks_device.luksdevice method)": [[20, "kiwi.storage.luks_device.LuksDevice.create_crypttab", false]], "create_custom_partitions() (kiwi.storage.disk.disk method)": [[20, "kiwi.storage.disk.Disk.create_custom_partitions", false]], "create_degraded_raid() (kiwi.storage.raid_device.raiddevice method)": [[20, "kiwi.storage.raid_device.RaidDevice.create_degraded_raid", false]], "create_disk() (kiwi.builder.disk.diskbuilder method)": [[9, "kiwi.builder.disk.DiskBuilder.create_disk", false]], "create_disk_format() (kiwi.builder.disk.diskbuilder method)": [[9, "kiwi.builder.disk.DiskBuilder.create_disk_format", false]], "create_efi_csm_partition() (kiwi.storage.disk.disk method)": [[20, "kiwi.storage.disk.Disk.create_efi_csm_partition", false]], "create_efi_partition() (kiwi.storage.disk.disk method)": [[20, "kiwi.storage.disk.Disk.create_efi_partition", false]], "create_efi_path() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.create_efi_path", false]], "create_fstab() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.create_fstab", false]], "create_gnu_gzip_compressed() (kiwi.archive.tar.archivetar method)": [[2, "kiwi.archive.tar.ArchiveTar.create_gnu_gzip_compressed", false]], "create_hybrid_mbr() (kiwi.storage.disk.disk method)": [[20, "kiwi.storage.disk.Disk.create_hybrid_mbr", false]], "create_image_format() (kiwi.storage.subformat.base.diskformatbase method)": [[21, "kiwi.storage.subformat.base.DiskFormatBase.create_image_format", false]], "create_image_format() (kiwi.storage.subformat.gce.diskformatgce method)": [[21, "kiwi.storage.subformat.gce.DiskFormatGce.create_image_format", false]], "create_image_format() (kiwi.storage.subformat.ova.diskformatova method)": [[21, "kiwi.storage.subformat.ova.DiskFormatOva.create_image_format", false]], "create_image_format() (kiwi.storage.subformat.qcow2.diskformatqcow2 method)": [[21, "kiwi.storage.subformat.qcow2.DiskFormatQcow2.create_image_format", false]], "create_image_format() (kiwi.storage.subformat.vagrant_base.diskformatvagrantbase method)": [[21, "kiwi.storage.subformat.vagrant_base.DiskFormatVagrantBase.create_image_format", false]], "create_image_format() (kiwi.storage.subformat.vdi.diskformatvdi method)": [[21, "kiwi.storage.subformat.vdi.DiskFormatVdi.create_image_format", false]], "create_image_format() (kiwi.storage.subformat.vhd.diskformatvhd method)": [[21, "kiwi.storage.subformat.vhd.DiskFormatVhd.create_image_format", false]], "create_image_format() (kiwi.storage.subformat.vhdfixed.diskformatvhdfixed method)": [[21, "kiwi.storage.subformat.vhdfixed.DiskFormatVhdFixed.create_image_format", false]], "create_image_format() (kiwi.storage.subformat.vhdx.diskformatvhdx method)": [[21, "kiwi.storage.subformat.vhdx.DiskFormatVhdx.create_image_format", false]], "create_image_format() (kiwi.storage.subformat.vmdk.diskformatvmdk method)": [[21, "kiwi.storage.subformat.vmdk.DiskFormatVmdk.create_image_format", false]], "create_init_link_from_linuxrc() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.create_init_link_from_linuxrc", false]], "create_initrd() (kiwi.boot.image.base.bootimagebase method)": [[4, "kiwi.boot.image.base.BootImageBase.create_initrd", false]], "create_initrd() (kiwi.boot.image.builtin_kiwi.bootimagekiwi method)": [[4, "kiwi.boot.image.builtin_kiwi.BootImageKiwi.create_initrd", false]], "create_initrd() (kiwi.boot.image.dracut.bootimagedracut method)": [[4, "kiwi.boot.image.dracut.BootImageDracut.create_initrd", false]], "create_install_iso() (kiwi.builder.install.installimagebuilder method)": [[9, "kiwi.builder.install.InstallImageBuilder.create_install_iso", false]], "create_install_media() (kiwi.builder.disk.diskbuilder method)": [[9, "kiwi.builder.disk.DiskBuilder.create_install_media", false]], "create_install_pxe_archive() (kiwi.builder.install.installimagebuilder method)": [[9, "kiwi.builder.install.InstallImageBuilder.create_install_pxe_archive", false]], "create_iso() (kiwi.iso_tools.base.isotoolsbase method)": [[13, "kiwi.iso_tools.base.IsoToolsBase.create_iso", false]], "create_iso() (kiwi.iso_tools.xorriso.isotoolsxorriso method)": [[13, "kiwi.iso_tools.xorriso.IsoToolsXorrIso.create_iso", false]], "create_loader_image() (kiwi.bootloader.config.systemd_boot.bootloadersystemdboot method)": [[6, "kiwi.bootloader.config.systemd_boot.BootLoaderSystemdBoot.create_loader_image", false]], "create_loader_image() (kiwi.bootloader.config.zipl.bootloaderzipl method)": [[6, "kiwi.bootloader.config.zipl.BootLoaderZipl.create_loader_image", false]], "create_match_method() (kiwi.command_process.commandprocess method)": [[1, "kiwi.command_process.CommandProcess.create_match_method", false]], "create_mbr() (kiwi.storage.disk.disk method)": [[20, "kiwi.storage.disk.Disk.create_mbr", false]], "create_on_device() (kiwi.filesystem.base.filesystembase method)": [[12, "kiwi.filesystem.base.FileSystemBase.create_on_device", false]], "create_on_device() (kiwi.filesystem.btrfs.filesystembtrfs method)": [[12, "kiwi.filesystem.btrfs.FileSystemBtrfs.create_on_device", false]], "create_on_device() (kiwi.filesystem.ext2.filesystemext2 method)": [[12, "kiwi.filesystem.ext2.FileSystemExt2.create_on_device", false]], "create_on_device() (kiwi.filesystem.ext3.filesystemext3 method)": [[12, "kiwi.filesystem.ext3.FileSystemExt3.create_on_device", false]], "create_on_device() (kiwi.filesystem.ext4.filesystemext4 method)": [[12, "kiwi.filesystem.ext4.FileSystemExt4.create_on_device", false]], "create_on_device() (kiwi.filesystem.fat16.filesystemfat16 method)": [[12, "kiwi.filesystem.fat16.FileSystemFat16.create_on_device", false]], "create_on_device() (kiwi.filesystem.fat32.filesystemfat32 method)": [[12, "kiwi.filesystem.fat32.FileSystemFat32.create_on_device", false]], "create_on_device() (kiwi.filesystem.xfs.filesystemxfs method)": [[12, "kiwi.filesystem.xfs.FileSystemXfs.create_on_device", false]], "create_on_file() (kiwi.filesystem.base.filesystembase method)": [[12, "kiwi.filesystem.base.FileSystemBase.create_on_file", false]], "create_on_file() (kiwi.filesystem.isofs.filesystemisofs method)": [[12, "kiwi.filesystem.isofs.FileSystemIsoFs.create_on_file", false]], "create_on_file() (kiwi.filesystem.squashfs.filesystemsquashfs method)": [[12, "kiwi.filesystem.squashfs.FileSystemSquashFs.create_on_file", false]], "create_prep_partition() (kiwi.storage.disk.disk method)": [[20, "kiwi.storage.disk.Disk.create_prep_partition", false]], "create_raid_config() (kiwi.storage.raid_device.raiddevice method)": [[20, "kiwi.storage.raid_device.RaidDevice.create_raid_config", false]], "create_random_keyfile() (kiwi.storage.luks_device.luksdevice static method)": [[20, "kiwi.storage.luks_device.LuksDevice.create_random_keyfile", false]], "create_recovery_archive() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.create_recovery_archive", false]], "create_repository_solvable() (kiwi.solver.repository.base.solverrepositorybase method)": [[19, "kiwi.solver.repository.base.SolverRepositoryBase.create_repository_solvable", false]], "create_root_lvm_partition() (kiwi.storage.disk.disk method)": [[20, "kiwi.storage.disk.Disk.create_root_lvm_partition", false]], "create_root_partition() (kiwi.storage.disk.disk method)": [[20, "kiwi.storage.disk.Disk.create_root_partition", false]], "create_root_raid_partition() (kiwi.storage.disk.disk method)": [[20, "kiwi.storage.disk.Disk.create_root_raid_partition", false]], "create_root_readonly_partition() (kiwi.storage.disk.disk method)": [[20, "kiwi.storage.disk.Disk.create_root_readonly_partition", false]], "create_spare_partition() (kiwi.storage.disk.disk method)": [[20, "kiwi.storage.disk.Disk.create_spare_partition", false]], "create_swap_partition() (kiwi.storage.disk.disk method)": [[20, "kiwi.storage.disk.Disk.create_swap_partition", false]], "create_verification_metadata() (kiwi.filesystem.base.filesystembase method)": [[12, "kiwi.filesystem.base.FileSystemBase.create_verification_metadata", false]], "create_verification_metadata() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.create_verification_metadata", false]], "create_verity_layer() (kiwi.filesystem.base.filesystembase method)": [[12, "kiwi.filesystem.base.FileSystemBase.create_verity_layer", false]], "create_verity_layer() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.create_verity_layer", false]], "create_volume_paths_in_root_dir() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.create_volume_paths_in_root_dir", false]], "create_volumes() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.create_volumes", false]], "create_volumes() (kiwi.volume_manager.btrfs.volumemanagerbtrfs method)": [[26, "kiwi.volume_manager.btrfs.VolumeManagerBtrfs.create_volumes", false]], "create_volumes() (kiwi.volume_manager.lvm.volumemanagerlvm method)": [[26, "kiwi.volume_manager.lvm.VolumeManagerLVM.create_volumes", false]], "create_xz_compressed() (kiwi.archive.tar.archivetar method)": [[2, "kiwi.archive.tar.ArchiveTar.create_xz_compressed", false]], "credentials_file_name() (kiwi.system.uri.uri method)": [[23, "kiwi.system.uri.Uri.credentials_file_name", false]], "custom_args (kiwi.volume_manager.base.volumemanagerbase attribute)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.custom_args", false]], "custom_filesystem_args (kiwi.volume_manager.base.volumemanagerbase attribute)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.custom_filesystem_args", false]], "customize() (kiwi.system.size.systemsize method)": [[23, "kiwi.system.size.SystemSize.customize", false]], "database_consistent() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.database_consistent", false]], "datasync (class in kiwi.utils.sync)": [[25, "kiwi.utils.sync.DataSync", false]], "deactivate_bootloader_setup() (kiwi.container.setup.base.containersetupbase method)": [[11, "kiwi.container.setup.base.ContainerSetupBase.deactivate_bootloader_setup", false]], "deactivate_root_filesystem_check() (kiwi.container.setup.base.containersetupbase method)": [[11, "kiwi.container.setup.base.ContainerSetupBase.deactivate_root_filesystem_check", false]], "deactivate_systemd_service() (kiwi.container.setup.base.containersetupbase method)": [[11, "kiwi.container.setup.base.ContainerSetupBase.deactivate_systemd_service", false]], "debugfilter (class in kiwi.logger_filter)": [[1, "kiwi.logger_filter.DebugFilter", false]], "defaults (class in kiwi.defaults)": [[1, "kiwi.defaults.Defaults", false]], "delete() (kiwi.system.profile.profile method)": [[23, "kiwi.system.profile.Profile.delete", false]], "delete() (kiwi.system.root_init.rootinit method)": [[23, "kiwi.system.root_init.RootInit.delete", false]], "delete_all_repos() (kiwi.repository.base.repositorybase method)": [[16, "kiwi.repository.base.RepositoryBase.delete_all_repos", false]], "delete_all_repos() (kiwi.repository.dnf4.repositorydnf4 method)": [[16, "kiwi.repository.dnf4.RepositoryDnf4.delete_all_repos", false]], "delete_all_repos() (kiwi.repository.zypper.repositoryzypper method)": [[16, "kiwi.repository.zypper.RepositoryZypper.delete_all_repos", false]], "delete_packages() (kiwi.system.prepare.systemprepare method)": [[23, "kiwi.system.prepare.SystemPrepare.delete_packages", false]], "delete_repo() (kiwi.repository.base.repositorybase method)": [[16, "kiwi.repository.base.RepositoryBase.delete_repo", false]], "delete_repo() (kiwi.repository.dnf4.repositorydnf4 method)": [[16, "kiwi.repository.dnf4.RepositoryDnf4.delete_repo", false]], "delete_repo() (kiwi.repository.zypper.repositoryzypper method)": [[16, "kiwi.repository.zypper.RepositoryZypper.delete_repo", false]], "delete_repo_cache() (kiwi.repository.base.repositorybase method)": [[16, "kiwi.repository.base.RepositoryBase.delete_repo_cache", false]], "delete_repo_cache() (kiwi.repository.dnf4.repositorydnf4 method)": [[16, "kiwi.repository.dnf4.RepositoryDnf4.delete_repo_cache", false]], "delete_repo_cache() (kiwi.repository.zypper.repositoryzypper method)": [[16, "kiwi.repository.zypper.RepositoryZypper.delete_repo_cache", false]], "delete_repository_sections() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.delete_repository_sections", false]], "delete_repository_sections_used_for_build() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.delete_repository_sections_used_for_build", false]], "description_type (class in kiwi.xml_state)": [[1, "kiwi.xml_state.description_type", false]], "device (kiwi.volume_manager.base.volumemanagerbase attribute)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.device", false]], "device_map (kiwi.volume_manager.base.volumemanagerbase attribute)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.device_map", false]], "device_provider_root (kiwi.volume_manager.base.volumemanagerbase attribute)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.device_provider_root", false]], "deviceprovider (class in kiwi.storage.device_provider)": [[20, "kiwi.storage.device_provider.DeviceProvider", false]], "disk (class in kiwi.storage.disk)": [[20, "kiwi.storage.disk.Disk", false]], "diskbuilder (class in kiwi.builder.disk)": [[9, "kiwi.builder.disk.DiskBuilder", false]], "diskformat (class in kiwi.storage.subformat)": [[21, "kiwi.storage.subformat.DiskFormat", false]], "diskformatbase (class in kiwi.storage.subformat.base)": [[21, "kiwi.storage.subformat.base.DiskFormatBase", false]], "diskformatgce (class in kiwi.storage.subformat.gce)": [[21, "kiwi.storage.subformat.gce.DiskFormatGce", false]], "diskformatova (class in kiwi.storage.subformat.ova)": [[21, "kiwi.storage.subformat.ova.DiskFormatOva", false]], "diskformatqcow2 (class in kiwi.storage.subformat.qcow2)": [[21, "kiwi.storage.subformat.qcow2.DiskFormatQcow2", false]], "diskformatvagrantbase (class in kiwi.storage.subformat.vagrant_base)": [[21, "kiwi.storage.subformat.vagrant_base.DiskFormatVagrantBase", false]], "diskformatvagrantlibvirt (class in kiwi.storage.subformat.vagrant_libvirt)": [[21, "kiwi.storage.subformat.vagrant_libvirt.DiskFormatVagrantLibVirt", false]], "diskformatvagrantvirtualbox (class in kiwi.storage.subformat.vagrant_virtualbox)": [[21, "kiwi.storage.subformat.vagrant_virtualbox.DiskFormatVagrantVirtualBox", false]], "diskformatvdi (class in kiwi.storage.subformat.vdi)": [[21, "kiwi.storage.subformat.vdi.DiskFormatVdi", false]], "diskformatvhd (class in kiwi.storage.subformat.vhd)": [[21, "kiwi.storage.subformat.vhd.DiskFormatVhd", false]], "diskformatvhdfixed (class in kiwi.storage.subformat.vhdfixed)": [[21, "kiwi.storage.subformat.vhdfixed.DiskFormatVhdFixed", false]], "diskformatvhdx (class in kiwi.storage.subformat.vhdx)": [[21, "kiwi.storage.subformat.vhdx.DiskFormatVhdx", false]], "diskformatvmdk (class in kiwi.storage.subformat.vmdk)": [[21, "kiwi.storage.subformat.vmdk.DiskFormatVmdk", false]], "disksetup (class in kiwi.storage.setup)": [[20, "kiwi.storage.setup.DiskSetup", false]], "download_from_repository() (kiwi.solver.repository.base.solverrepositorybase method)": [[19, "kiwi.solver.repository.base.SolverRepositoryBase.download_from_repository", false]], "dracut_module_type (class in kiwi.runtime_checker)": [[1, "kiwi.runtime_checker.dracut_module_type", false]], "dump() (kiwi.system.result.result method)": [[23, "kiwi.system.result.Result.dump", false]], "dump_reload_package_database() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.dump_reload_package_database", false]], "ec2_mode() (kiwi.firmware.firmware method)": [[1, "kiwi.firmware.FirmWare.ec2_mode", false]], "efi_mode() (kiwi.firmware.firmware method)": [[1, "kiwi.firmware.FirmWare.efi_mode", false]], "entry_command (kiwi.container.oci.ociconfig attribute)": [[10, "kiwi.container.oci.OciConfig.entry_command", false]], "entry_subcommand (kiwi.container.oci.ociconfig attribute)": [[10, "kiwi.container.oci.OciConfig.entry_subcommand", false]], "environment (kiwi.container.oci.ociconfig attribute)": [[10, "kiwi.container.oci.OciConfig.environment", false]], "error (kiwi.command.commandcallt attribute)": [[1, "kiwi.command.CommandCallT.error", false]], "error (kiwi.command.commandt attribute)": [[1, "kiwi.command.CommandT.error", false]], "error_available (kiwi.command.commandcallt attribute)": [[1, "kiwi.command.CommandCallT.error_available", false]], "errorfilter (class in kiwi.logger_filter)": [[1, "kiwi.logger_filter.ErrorFilter", false]], "export_modprobe_setup() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.export_modprobe_setup", false]], "export_package_changes() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.export_package_changes", false]], "export_package_list() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.export_package_list", false]], "export_package_verification() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.export_package_verification", false]], "expose_ports (kiwi.container.oci.ociconfig attribute)": [[10, "kiwi.container.oci.OciConfig.expose_ports", false]], "extract() (kiwi.archive.cpio.archivecpio method)": [[2, "kiwi.archive.cpio.ArchiveCpio.extract", false]], "extract() (kiwi.archive.tar.archivetar method)": [[2, "kiwi.archive.tar.ArchiveTar.extract", false]], "extras() (in module kiwi.kiwi)": [[1, "kiwi.kiwi.extras", false]], "failsafe_boot_entry_requested() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.failsafe_boot_entry_requested", false]], "fetch_command (kiwi.xml_state.containert attribute)": [[1, "kiwi.xml_state.ContainerT.fetch_command", false]], "fetch_only (kiwi.xml_state.containert attribute)": [[1, "kiwi.xml_state.ContainerT.fetch_only", false]], "filename (kiwi.defaults.grub_loader_type attribute)": [[1, "kiwi.defaults.grub_loader_type.filename", false]], "filename (kiwi.defaults.shim_loader_type attribute)": [[1, "kiwi.defaults.shim_loader_type.filename", false]], "filename (kiwi.system.kernel.kernel_type attribute)": [[23, "kiwi.system.kernel.kernel_type.filename", false]], "filename (kiwi.system.kernel.xen_hypervisor_type attribute)": [[23, "kiwi.system.kernel.xen_hypervisor_type.filename", false]], "filename (kiwi.system.result.result_file_type attribute)": [[23, "kiwi.system.result.result_file_type.filename", false]], "filesystem (class in kiwi.filesystem)": [[12, "kiwi.filesystem.FileSystem", false]], "filesystem (kiwi.storage.disk.ptable_entry_type attribute)": [[20, "kiwi.storage.disk.ptable_entry_type.filesystem", false]], "filesystembase (class in kiwi.filesystem.base)": [[12, "kiwi.filesystem.base.FileSystemBase", false]], "filesystembtrfs (class in kiwi.filesystem.btrfs)": [[12, "kiwi.filesystem.btrfs.FileSystemBtrfs", false]], "filesystembuilder (class in kiwi.builder.filesystem)": [[9, "kiwi.builder.filesystem.FileSystemBuilder", false]], "filesystemext2 (class in kiwi.filesystem.ext2)": [[12, "kiwi.filesystem.ext2.FileSystemExt2", false]], "filesystemext3 (class in kiwi.filesystem.ext3)": [[12, "kiwi.filesystem.ext3.FileSystemExt3", false]], "filesystemext4 (class in kiwi.filesystem.ext4)": [[12, "kiwi.filesystem.ext4.FileSystemExt4", false]], "filesystemfat16 (class in kiwi.filesystem.fat16)": [[12, "kiwi.filesystem.fat16.FileSystemFat16", false]], "filesystemfat32 (class in kiwi.filesystem.fat32)": [[12, "kiwi.filesystem.fat32.FileSystemFat32", false]], "filesystemisofs (class in kiwi.filesystem.isofs)": [[12, "kiwi.filesystem.isofs.FileSystemIsoFs", false]], "filesystemsetup (class in kiwi.filesystem.setup)": [[12, "kiwi.filesystem.setup.FileSystemSetup", false]], "filesystemsquashfs (class in kiwi.filesystem.squashfs)": [[12, "kiwi.filesystem.squashfs.FileSystemSquashFs", false]], "filesystemxfs (class in kiwi.filesystem.xfs)": [[12, "kiwi.filesystem.xfs.FileSystemXfs", false]], "filet (class in kiwi.xml_state)": [[1, "kiwi.xml_state.FileT", false]], "filter() (kiwi.logger_filter.debugfilter method)": [[1, "kiwi.logger_filter.DebugFilter.filter", false]], "filter() (kiwi.logger_filter.errorfilter method)": [[1, "kiwi.logger_filter.ErrorFilter.filter", false]], "filter() (kiwi.logger_filter.infofilter method)": [[1, "kiwi.logger_filter.InfoFilter.filter", false]], "filter() (kiwi.logger_filter.loggerschedulerfilter method)": [[1, "kiwi.logger_filter.LoggerSchedulerFilter.filter", false]], "filter() (kiwi.logger_filter.warningfilter method)": [[1, "kiwi.logger_filter.WarningFilter.filter", false]], "firmware (class in kiwi.firmware)": [[1, "kiwi.firmware.FirmWare", false]], "format() (kiwi.logger_color_formatter.colorformatter method)": [[1, "kiwi.logger_color_formatter.ColorFormatter.format", false]], "format_message() (kiwi.logger_color_formatter.colormessage method)": [[1, "kiwi.logger_color_formatter.ColorMessage.format_message", false]], "format_to_variable_value() (kiwi.system.shell.shell static method)": [[23, "kiwi.system.shell.Shell.format_to_variable_value", false]], "fullsize (kiwi.xml_state.volume_type attribute)": [[1, "kiwi.xml_state.volume_type.fullsize", false]], "gb (kiwi.defaults.unit_type attribute)": [[1, "kiwi.defaults.unit_type.gb", false]], "get() (kiwi.defaults.defaults method)": [[1, "kiwi.defaults.Defaults.get", false]], "get() (kiwi.utils.sysconfig.sysconfig method)": [[25, "kiwi.utils.sysconfig.SysConfig.get", false]], "get_additional_metadata() (kiwi.storage.subformat.vagrant_base.diskformatvagrantbase method)": [[21, "kiwi.storage.subformat.vagrant_base.DiskFormatVagrantBase.get_additional_metadata", false]], "get_additional_metadata() (kiwi.storage.subformat.vagrant_libvirt.diskformatvagrantlibvirt method)": [[21, "kiwi.storage.subformat.vagrant_libvirt.DiskFormatVagrantLibVirt.get_additional_metadata", false]], "get_additional_vagrant_config_settings() (kiwi.storage.subformat.vagrant_base.diskformatvagrantbase method)": [[21, "kiwi.storage.subformat.vagrant_base.DiskFormatVagrantBase.get_additional_vagrant_config_settings", false]], "get_additional_vagrant_config_settings() (kiwi.storage.subformat.vagrant_libvirt.diskformatvagrantlibvirt method)": [[21, "kiwi.storage.subformat.vagrant_libvirt.DiskFormatVagrantLibVirt.get_additional_vagrant_config_settings", false]], "get_additional_vagrant_config_settings() (kiwi.storage.subformat.vagrant_virtualbox.diskformatvagrantvirtualbox method)": [[21, "kiwi.storage.subformat.vagrant_virtualbox.DiskFormatVagrantVirtualBox.get_additional_vagrant_config_settings", false]], "get_archive_image_types() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_archive_image_types", false]], "get_archives_target_dirs() (kiwi.xml_state.xmlstate static method)": [[1, "kiwi.xml_state.XMLState.get_archives_target_dirs", false]], "get_attributes() (kiwi.mount_manager.mountmanager method)": [[1, "kiwi.mount_manager.MountManager.get_attributes", false]], "get_bios_image_name() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_bios_image_name", false]], "get_bios_module_directory_name() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_bios_module_directory_name", false]], "get_blkid() (kiwi.utils.block.blockid method)": [[25, "kiwi.utils.block.BlockID.get_blkid", false]], "get_bls_loader_entries_dir() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_bls_loader_entries_dir", false]], "get_boot_cmdline() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.get_boot_cmdline", false]], "get_boot_description_directory() (kiwi.boot.image.base.bootimagebase method)": [[4, "kiwi.boot.image.base.BootImageBase.get_boot_description_directory", false]], "get_boot_image_description_path() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_boot_image_description_path", false]], "get_boot_image_strip_file() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_boot_image_strip_file", false]], "get_boot_label() (kiwi.storage.setup.disksetup static method)": [[20, "kiwi.storage.setup.DiskSetup.get_boot_label", false]], "get_boot_names() (kiwi.boot.image.base.bootimagebase method)": [[4, "kiwi.boot.image.base.BootImageBase.get_boot_names", false]], "get_boot_path() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.get_boot_path", false]], "get_boot_theme() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.get_boot_theme", false]], "get_boot_timeout_seconds() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.get_boot_timeout_seconds", false]], "get_bootloader_config_options() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_bootloader_config_options", false]], "get_bootloader_install_options() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_bootloader_install_options", false]], "get_bootloader_options() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_bootloader_options", false]], "get_bootloader_shim_options() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_bootloader_shim_options", false]], "get_bootstrap_archives() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_bootstrap_archives", false]], "get_bootstrap_archives_target_dirs() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_bootstrap_archives_target_dirs", false]], "get_bootstrap_collection_type() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_bootstrap_collection_type", false]], "get_bootstrap_collections() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_bootstrap_collections", false]], "get_bootstrap_files() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_bootstrap_files", false]], "get_bootstrap_ignore_packages() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_bootstrap_ignore_packages", false]], "get_bootstrap_package_name() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_bootstrap_package_name", false]], "get_bootstrap_packages() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_bootstrap_packages", false]], "get_bootstrap_packages_sections() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_bootstrap_packages_sections", false]], "get_bootstrap_products() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_bootstrap_products", false]], "get_build_type_bootloader_bls() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_bootloader_bls", false]], "get_build_type_bootloader_console() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_bootloader_console", false]], "get_build_type_bootloader_name() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_bootloader_name", false]], "get_build_type_bootloader_section() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_bootloader_section", false]], "get_build_type_bootloader_securelinux_section() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_bootloader_securelinux_section", false]], "get_build_type_bootloader_serial_line_setup() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_bootloader_serial_line_setup", false]], "get_build_type_bootloader_settings_section() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_bootloader_settings_section", false]], "get_build_type_bootloader_targettype() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_bootloader_targettype", false]], "get_build_type_bootloader_timeout() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_bootloader_timeout", false]], "get_build_type_bootloader_timeout_style() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_bootloader_timeout_style", false]], "get_build_type_bootloader_use_disk_password() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_bootloader_use_disk_password", false]], "get_build_type_bundle_format() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_bundle_format", false]], "get_build_type_containerconfig_section() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_containerconfig_section", false]], "get_build_type_format_options() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_format_options", false]], "get_build_type_machine_section() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_machine_section", false]], "get_build_type_name() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_name", false]], "get_build_type_oemconfig_section() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_oemconfig_section", false]], "get_build_type_partitions_section() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_partitions_section", false]], "get_build_type_size() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_size", false]], "get_build_type_spare_part_fs_attributes() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_spare_part_fs_attributes", false]], "get_build_type_spare_part_size() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_spare_part_size", false]], "get_build_type_system_disk_section() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_system_disk_section", false]], "get_build_type_unpartitioned_bytes() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_unpartitioned_bytes", false]], "get_build_type_vagrant_config_section() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_vagrant_config_section", false]], "get_build_type_vmconfig_entries() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_vmconfig_entries", false]], "get_build_type_vmdisk_section() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_vmdisk_section", false]], "get_build_type_vmdvd_section() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_vmdvd_section", false]], "get_build_type_vmnic_entries() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_vmnic_entries", false]], "get_buildservice_env_name() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_buildservice_env_name", false]], "get_bundle_compression() (kiwi.runtime_config.runtimeconfig method)": [[1, "kiwi.runtime_config.RuntimeConfig.get_bundle_compression", false]], "get_byte_size() (kiwi.storage.device_provider.deviceprovider method)": [[20, "kiwi.storage.device_provider.DeviceProvider.get_byte_size", false]], "get_canonical_volume_list() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.get_canonical_volume_list", false]], "get_collection_modules() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_collection_modules", false]], "get_collection_type() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_collection_type", false]], "get_collections() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_collections", false]], "get_command() (kiwi.cli.cli method)": [[1, "kiwi.cli.Cli.get_command", false]], "get_command_args() (kiwi.cli.cli method)": [[1, "kiwi.cli.Cli.get_command_args", false]], "get_common_functions_file() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_common_functions_file", false]], "get_container_base_image_tag() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_container_base_image_tag", false]], "get_container_compression() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_container_compression", false]], "get_container_compression() (kiwi.runtime_config.runtimeconfig method)": [[1, "kiwi.runtime_config.RuntimeConfig.get_container_compression", false]], "get_container_config() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_container_config", false]], "get_container_image_types() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_container_image_types", false]], "get_container_name() (kiwi.container.setup.base.containersetupbase method)": [[11, "kiwi.container.setup.base.ContainerSetupBase.get_container_name", false]], "get_containers() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_containers", false]], "get_containers_sections() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_containers_sections", false]], "get_continue_on_timeout() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.get_continue_on_timeout", false]], "get_credentials_verification_metadata_signing_key_file() (kiwi.runtime_config.runtimeconfig method)": [[1, "kiwi.runtime_config.RuntimeConfig.get_credentials_verification_metadata_signing_key_file", false]], "get_custom_rpm_bootstrap_macro_name() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_custom_rpm_bootstrap_macro_name", false]], "get_custom_rpm_image_macro_name() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_custom_rpm_image_macro_name", false]], "get_custom_rpm_macros_path() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_custom_rpm_macros_path", false]], "get_default_boot_mbytes() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_default_boot_mbytes", false]], "get_default_boot_timeout_seconds() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_default_boot_timeout_seconds", false]], "get_default_bootloader() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_default_bootloader", false]], "get_default_container_created_by() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_default_container_created_by", false]], "get_default_container_name() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_default_container_name", false]], "get_default_container_subcommand() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_default_container_subcommand", false]], "get_default_container_tag() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_default_container_tag", false]], "get_default_disk_start_sector() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_default_disk_start_sector", false]], "get_default_efi_boot_mbytes() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_default_efi_boot_mbytes", false]], "get_default_efi_partition_table_type() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_default_efi_partition_table_type", false]], "get_default_firmware() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_default_firmware", false]], "get_default_inode_size() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_default_inode_size", false]], "get_default_legacy_bios_mbytes() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_default_legacy_bios_mbytes", false]], "get_default_live_iso_root_filesystem() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_default_live_iso_root_filesystem", false]], "get_default_live_iso_type() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_default_live_iso_type", false]], "get_default_package_manager() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_default_package_manager", false]], "get_default_packager_tool() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_default_packager_tool", false]], "get_default_prep_mbytes() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_default_prep_mbytes", false]], "get_default_uri_type() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_default_uri_type", false]], "get_default_video_mode() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_default_video_mode", false]], "get_default_volume_group_name() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_default_volume_group_name", false]], "get_derived_from_image_uri() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_derived_from_image_uri", false]], "get_description_section() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_description_section", false]], "get_device() (kiwi.storage.device_provider.deviceprovider method)": [[20, "kiwi.storage.device_provider.DeviceProvider.get_device", false]], "get_device() (kiwi.storage.disk.disk method)": [[20, "kiwi.storage.disk.Disk.get_device", false]], "get_device() (kiwi.storage.loop_device.loopdevice method)": [[20, "kiwi.storage.loop_device.LoopDevice.get_device", false]], "get_device() (kiwi.storage.luks_device.luksdevice method)": [[20, "kiwi.storage.luks_device.LuksDevice.get_device", false]], "get_device() (kiwi.storage.mapped_device.mappeddevice method)": [[20, "kiwi.storage.mapped_device.MappedDevice.get_device", false]], "get_device() (kiwi.storage.raid_device.raiddevice method)": [[20, "kiwi.storage.raid_device.RaidDevice.get_device", false]], "get_device() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.get_device", false]], "get_device() (kiwi.volume_manager.lvm.volumemanagerlvm method)": [[26, "kiwi.volume_manager.lvm.VolumeManagerLVM.get_device", false]], "get_disabled_runtime_checks() (kiwi.runtime_config.runtimeconfig method)": [[1, "kiwi.runtime_config.RuntimeConfig.get_disabled_runtime_checks", false]], "get_discoverable_partition_ids() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_discoverable_partition_ids", false]], "get_discoverable_partition_ids() (kiwi.storage.disk.disk method)": [[20, "kiwi.storage.disk.Disk.get_discoverable_partition_ids", false]], "get_disk_format_types() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_disk_format_types", false]], "get_disk_image_types() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_disk_image_types", false]], "get_disk_start_sector() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_disk_start_sector", false]], "get_disksize_mbytes() (kiwi.storage.setup.disksetup method)": [[20, "kiwi.storage.setup.DiskSetup.get_disksize_mbytes", false]], "get_distribution_name_from_boot_attribute() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_distribution_name_from_boot_attribute", false]], "get_dracut_conf_name() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_dracut_conf_name", false]], "get_drivers_list() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_drivers_list", false]], "get_ec2_capable_firmware_names() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_ec2_capable_firmware_names", false]], "get_efi_capable_firmware_names() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_efi_capable_firmware_names", false]], "get_efi_image_name() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_efi_image_name", false]], "get_efi_label() (kiwi.storage.setup.disksetup static method)": [[20, "kiwi.storage.setup.DiskSetup.get_efi_label", false]], "get_efi_module_directory_name() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_efi_module_directory_name", false]], "get_efi_partition_size() (kiwi.firmware.firmware method)": [[1, "kiwi.firmware.FirmWare.get_efi_partition_size", false]], "get_efi_vendor_directory() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_efi_vendor_directory", false]], "get_enclaves_image_types() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_enclaves_image_types", false]], "get_error_code() (kiwi.command_process.commanditerator method)": [[1, "kiwi.command_process.CommandIterator.get_error_code", false]], "get_error_details() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.get_error_details", false]], "get_error_output() (kiwi.command_process.commanditerator method)": [[1, "kiwi.command_process.CommandIterator.get_error_output", false]], "get_exclude_list_for_non_physical_devices() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_exclude_list_for_non_physical_devices", false]], "get_exclude_list_for_removed_files_detection() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_exclude_list_for_removed_files_detection", false]], "get_exclude_list_for_root_data_sync() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_exclude_list_for_root_data_sync", false]], "get_exclude_list_from_custom_exclude_files() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_exclude_list_from_custom_exclude_files", false]], "get_extension_xml_data() (kiwi.xml_description.xmldescription method)": [[1, "kiwi.xml_description.XMLDescription.get_extension_xml_data", false]], "get_failsafe_kernel_options() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_failsafe_kernel_options", false]], "get_filesystem() (kiwi.utils.block.blockid method)": [[25, "kiwi.utils.block.BlockID.get_filesystem", false]], "get_filesystem_image_types() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_filesystem_image_types", false]], "get_firmware_types() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_firmware_types", false]], "get_format() (kiwi.utils.compress.compress method)": [[25, "kiwi.utils.compress.Compress.get_format", false]], "get_fragment() (kiwi.system.uri.uri method)": [[23, "kiwi.system.uri.Uri.get_fragment", false]], "get_fs_create_option_list() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_fs_create_option_list", false]], "get_fs_mount_option_list() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_fs_mount_option_list", false]], "get_fstab() (kiwi.filesystem.base.filesystembase method)": [[12, "kiwi.filesystem.base.FileSystemBase.get_fstab", false]], "get_fstab() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.get_fstab", false]], "get_fstab() (kiwi.volume_manager.btrfs.volumemanagerbtrfs method)": [[26, "kiwi.volume_manager.btrfs.VolumeManagerBtrfs.get_fstab", false]], "get_fstab() (kiwi.volume_manager.lvm.volumemanagerlvm method)": [[26, "kiwi.volume_manager.lvm.VolumeManagerLVM.get_fstab", false]], "get_gfxmode() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.get_gfxmode", false]], "get_global_args() (kiwi.cli.cli method)": [[1, "kiwi.cli.Cli.get_global_args", false]], "get_grub_basic_modules() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_grub_basic_modules", false]], "get_grub_bios_core_loader() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_grub_bios_core_loader", false]], "get_grub_bios_modules() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_grub_bios_modules", false]], "get_grub_boot_directory_name() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_grub_boot_directory_name", false]], "get_grub_custom_arguments() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_grub_custom_arguments", false]], "get_grub_efi_font_directory() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_grub_efi_font_directory", false]], "get_grub_efi_modules() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_grub_efi_modules", false]], "get_grub_ofw_modules() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_grub_ofw_modules", false]], "get_grub_path() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_grub_path", false]], "get_grub_s390_modules() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_grub_s390_modules", false]], "get_host_key_certificates() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_host_key_certificates", false]], "get_host_template() (kiwi.repository.template.apt.packagemanagertemplateaptget method)": [[17, "kiwi.repository.template.apt.PackageManagerTemplateAptGet.get_host_template", false]], "get_id() (kiwi.partitioner.base.partitionerbase method)": [[15, "kiwi.partitioner.base.PartitionerBase.get_id", false]], "get_id() (kiwi.system.identifier.systemidentifier method)": [[23, "kiwi.system.identifier.SystemIdentifier.get_id", false]], "get_ignore_packages() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_ignore_packages", false]], "get_image_packages_sections() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_image_packages_sections", false]], "get_image_template() (kiwi.repository.template.apt.packagemanagertemplateaptget method)": [[17, "kiwi.repository.template.apt.PackageManagerTemplateAptGet.get_image_template", false]], "get_image_version() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_image_version", false]], "get_imported_root_image() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_imported_root_image", false]], "get_include_section_reference_file_names() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_include_section_reference_file_names", false]], "get_initrd_system() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_initrd_system", false]], "get_install_image_boot_default() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.get_install_image_boot_default", false]], "get_install_template() (kiwi.bootloader.template.grub2.bootloadertemplategrub2 method)": [[8, "kiwi.bootloader.template.grub2.BootLoaderTemplateGrub2.get_install_template", false]], "get_install_volume_id() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_install_volume_id", false]], "get_installmedia_initrd_modules() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_installmedia_initrd_modules", false]], "get_iso_boot_path() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_iso_boot_path", false]], "get_iso_grub_loader() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_iso_grub_loader", false]], "get_iso_grub_mbr() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_iso_grub_mbr", false]], "get_iso_media_tag_tool() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_iso_media_tag_tool", false]], "get_iso_media_tag_tool() (kiwi.runtime_config.runtimeconfig method)": [[1, "kiwi.runtime_config.RuntimeConfig.get_iso_media_tag_tool", false]], "get_iso_template() (kiwi.bootloader.template.grub2.bootloadertemplategrub2 method)": [[8, "kiwi.bootloader.template.grub2.BootLoaderTemplateGrub2.get_iso_template", false]], "get_iso_tool_category() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_iso_tool_category", false]], "get_iso_tool_category() (kiwi.runtime_config.runtimeconfig method)": [[1, "kiwi.runtime_config.RuntimeConfig.get_iso_tool_category", false]], "get_kernel() (kiwi.system.kernel.kernel method)": [[23, "kiwi.system.kernel.Kernel.get_kernel", false]], "get_kis_image_types() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_kis_image_types", false]], "get_label() (kiwi.utils.block.blockid method)": [[25, "kiwi.utils.block.BlockID.get_label", false]], "get_legacy_bios_partition_size() (kiwi.firmware.firmware method)": [[1, "kiwi.firmware.FirmWare.get_legacy_bios_partition_size", false]], "get_live_dracut_modules_from_flag() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_live_dracut_modules_from_flag", false]], "get_live_image_types() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_live_image_types", false]], "get_live_iso_persistent_boot_options() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_live_iso_persistent_boot_options", false]], "get_locale() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_locale", false]], "get_logfile() (kiwi.logger.logger method)": [[1, "kiwi.logger.Logger.get_logfile", false]], "get_luks_credentials() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_luks_credentials", false]], "get_luks_format_options() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_luks_format_options", false]], "get_luks_key_length() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_luks_key_length", false]], "get_lvm_overhead_mbytes() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_lvm_overhead_mbytes", false]], "get_mapper_tool() (kiwi.runtime_config.runtimeconfig method)": [[1, "kiwi.runtime_config.RuntimeConfig.get_mapper_tool", false]], "get_max_size_constraint() (kiwi.runtime_config.runtimeconfig method)": [[1, "kiwi.runtime_config.RuntimeConfig.get_max_size_constraint", false]], "get_menu_entry_install_title() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.get_menu_entry_install_title", false]], "get_menu_entry_title() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.get_menu_entry_title", false]], "get_min_partition_mbytes() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_min_partition_mbytes", false]], "get_min_volume_mbytes() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_min_volume_mbytes", false]], "get_mok_manager() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_mok_manager", false]], "get_mountpoint() (kiwi.filesystem.base.filesystembase method)": [[12, "kiwi.filesystem.base.FileSystemBase.get_mountpoint", false]], "get_mountpoint() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.get_mountpoint", false]], "get_mountpoint() (kiwi.volume_manager.btrfs.volumemanagerbtrfs method)": [[26, "kiwi.volume_manager.btrfs.VolumeManagerBtrfs.get_mountpoint", false]], "get_multiboot_install_template() (kiwi.bootloader.template.grub2.bootloadertemplategrub2 method)": [[8, "kiwi.bootloader.template.grub2.BootLoaderTemplateGrub2.get_multiboot_install_template", false]], "get_multiboot_iso_template() (kiwi.bootloader.template.grub2.bootloadertemplategrub2 method)": [[8, "kiwi.bootloader.template.grub2.BootLoaderTemplateGrub2.get_multiboot_iso_template", false]], "get_obs_api_credentials() (kiwi.runtime_config.runtimeconfig method)": [[1, "kiwi.runtime_config.RuntimeConfig.get_obs_api_credentials", false]], "get_obs_api_server_url() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_obs_api_server_url", false]], "get_obs_api_server_url() (kiwi.runtime_config.runtimeconfig method)": [[1, "kiwi.runtime_config.RuntimeConfig.get_obs_api_server_url", false]], "get_obs_download_server_url() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_obs_download_server_url", false]], "get_obs_download_server_url() (kiwi.runtime_config.runtimeconfig method)": [[1, "kiwi.runtime_config.RuntimeConfig.get_obs_download_server_url", false]], "get_oci_archive_tool() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_oci_archive_tool", false]], "get_oci_archive_tool() (kiwi.runtime_config.runtimeconfig method)": [[1, "kiwi.runtime_config.RuntimeConfig.get_oci_archive_tool", false]], "get_oemconfig_oem_multipath_scan() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_oemconfig_oem_multipath_scan", false]], "get_oemconfig_oem_resize() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_oemconfig_oem_resize", false]], "get_oemconfig_oem_systemsize() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_oemconfig_oem_systemsize", false]], "get_oemconfig_swap_mbytes() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_oemconfig_swap_mbytes", false]], "get_oemconfig_swap_name() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_oemconfig_swap_name", false]], "get_package_changes() (kiwi.runtime_config.runtimeconfig method)": [[1, "kiwi.runtime_config.RuntimeConfig.get_package_changes", false]], "get_package_manager() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_package_manager", false]], "get_package_sections() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_package_sections", false]], "get_packages_sections() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_packages_sections", false]], "get_part_mapper_tool() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_part_mapper_tool", false]], "get_partition_count() (kiwi.utils.block.blockid method)": [[25, "kiwi.utils.block.BlockID.get_partition_count", false]], "get_partition_table_type() (kiwi.firmware.firmware method)": [[1, "kiwi.firmware.FirmWare.get_partition_table_type", false]], "get_partitions() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_partitions", false]], "get_pid() (kiwi.command_process.commanditerator method)": [[1, "kiwi.command_process.CommandIterator.get_pid", false]], "get_platform_name() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_platform_name", false]], "get_preferences_sections() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_preferences_sections", false]], "get_prep_partition_size() (kiwi.firmware.firmware method)": [[1, "kiwi.firmware.FirmWare.get_prep_partition_size", false]], "get_preparer() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_preparer", false]], "get_products() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_products", false]], "get_profile_file() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_profile_file", false]], "get_public_partition_id_map() (kiwi.storage.disk.disk method)": [[20, "kiwi.storage.disk.Disk.get_public_partition_id_map", false]], "get_publisher() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_publisher", false]], "get_qemu_option_list() (kiwi.storage.subformat.base.diskformatbase static method)": [[21, "kiwi.storage.subformat.base.DiskFormatBase.get_qemu_option_list", false]], "get_recovery_spare_mbytes() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_recovery_spare_mbytes", false]], "get_release_version() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_release_version", false]], "get_removed_files_name() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_removed_files_name", false]], "get_repo_type() (kiwi.solver.repository.base.solverrepositorybase method)": [[19, "kiwi.solver.repository.base.SolverRepositoryBase.get_repo_type", false]], "get_repositories_signing_keys() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_repositories_signing_keys", false]], "get_repository_sections() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_repository_sections", false]], "get_repository_sections_used_for_build() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_repository_sections_used_for_build", false]], "get_repository_sections_used_in_image() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_repository_sections_used_in_image", false]], "get_results() (kiwi.system.result.result method)": [[23, "kiwi.system.result.Result.get_results", false]], "get_root_filesystem_uuid() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_root_filesystem_uuid", false]], "get_root_label() (kiwi.storage.setup.disksetup method)": [[20, "kiwi.storage.setup.DiskSetup.get_root_label", false]], "get_root_partition_uuid() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_root_partition_uuid", false]], "get_root_volume_name() (kiwi.filesystem.base.filesystembase method)": [[12, "kiwi.filesystem.base.FileSystemBase.get_root_volume_name", false]], "get_root_volume_name() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.get_root_volume_name", false]], "get_root_volume_name() (kiwi.volume_manager.btrfs.volumemanagerbtrfs method)": [[26, "kiwi.volume_manager.btrfs.VolumeManagerBtrfs.get_root_volume_name", false]], "get_rpm_check_signatures() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_rpm_check_signatures", false]], "get_rpm_excludedocs() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_rpm_excludedocs", false]], "get_rpm_locale() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_rpm_locale", false]], "get_rpm_locale_filtering() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_rpm_locale_filtering", false]], "get_runtime_checker_metadata() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_runtime_checker_metadata", false]], "get_schema_file() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_schema_file", false]], "get_schematron_module_name() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_schematron_module_name", false]], "get_servicename() (kiwi.cli.cli method)": [[1, "kiwi.cli.Cli.get_servicename", false]], "get_settings() (kiwi.system.profile.profile method)": [[23, "kiwi.system.profile.Profile.get_settings", false]], "get_shared_cache_location() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_shared_cache_location", false]], "get_shim_loader() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_shim_loader", false]], "get_shim_vendor_directory() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_shim_vendor_directory", false]], "get_signed_grub_loader() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_signed_grub_loader", false]], "get_size_mbytes() (kiwi.filesystem.setup.filesystemsetup method)": [[12, "kiwi.filesystem.setup.FileSystemSetup.get_size_mbytes", false]], "get_snapper_config_template_file() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_snapper_config_template_file", false]], "get_solvable_location() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_solvable_location", false]], "get_strip_files_to_delete() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_strip_files_to_delete", false]], "get_strip_libraries_to_keep() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_strip_libraries_to_keep", false]], "get_strip_list() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_strip_list", false]], "get_strip_tools_to_keep() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_strip_tools_to_keep", false]], "get_swapsize_mbytes() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_swapsize_mbytes", false]], "get_sync_options() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_sync_options", false]], "get_system_archives() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_system_archives", false]], "get_system_archives_target_dirs() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_system_archives_target_dirs", false]], "get_system_collection_type() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_system_collection_type", false]], "get_system_collections() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_system_collections", false]], "get_system_files() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_system_files", false]], "get_system_ignore_packages() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_system_ignore_packages", false]], "get_system_packages() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_system_packages", false]], "get_system_products() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_system_products", false]], "get_target_file_path_for_format() (kiwi.storage.subformat.base.diskformatbase method)": [[21, "kiwi.storage.subformat.base.DiskFormatBase.get_target_file_path_for_format", false]], "get_target_file_path_for_format() (kiwi.storage.subformat.gce.diskformatgce method)": [[21, "kiwi.storage.subformat.gce.DiskFormatGce.get_target_file_path_for_format", false]], "get_temp_location() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_temp_location", false]], "get_template() (kiwi.storage.subformat.template.vagrant_config.vagrantconfigtemplate method)": [[22, "kiwi.storage.subformat.template.vagrant_config.VagrantConfigTemplate.get_template", false]], "get_template() (kiwi.storage.subformat.template.virtualbox_ovf.virtualboxovftemplate method)": [[22, "kiwi.storage.subformat.template.virtualbox_ovf.VirtualboxOvfTemplate.get_template", false]], "get_template() (kiwi.storage.subformat.template.vmware_settings.vmwaresettingstemplate method)": [[22, "kiwi.storage.subformat.template.vmware_settings.VmwareSettingsTemplate.get_template", false]], "get_to_become_deleted_packages() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_to_become_deleted_packages", false]], "get_tool_name() (kiwi.iso_tools.base.isotoolsbase method)": [[13, "kiwi.iso_tools.base.IsoToolsBase.get_tool_name", false]], "get_tool_name() (kiwi.iso_tools.xorriso.isotoolsxorriso method)": [[13, "kiwi.iso_tools.xorriso.IsoToolsXorrIso.get_tool_name", false]], "get_unsigned_grub_loader() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_unsigned_grub_loader", false]], "get_user_groups() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_user_groups", false]], "get_users() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_users", false]], "get_users_sections() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_users_sections", false]], "get_uuid() (kiwi.storage.device_provider.deviceprovider method)": [[20, "kiwi.storage.device_provider.DeviceProvider.get_uuid", false]], "get_uuid() (kiwi.utils.block.blockid method)": [[25, "kiwi.utils.block.BlockID.get_uuid", false]], "get_vagrant_config_virtualbox_guest_additions() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_vagrant_config_virtualbox_guest_additions", false]], "get_vagrant_config_virtualbox_guest_additions() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_vagrant_config_virtualbox_guest_additions", false]], "get_vendor_grubenv() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_vendor_grubenv", false]], "get_video_mode_map() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_video_mode_map", false]], "get_volume_group_name() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_volume_group_name", false]], "get_volume_id() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_volume_id", false]], "get_volume_management() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_volume_management", false]], "get_volume_mbsize() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.get_volume_mbsize", false]], "get_volumes() (kiwi.filesystem.base.filesystembase method)": [[12, "kiwi.filesystem.base.FileSystemBase.get_volumes", false]], "get_volumes() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.get_volumes", false]], "get_volumes() (kiwi.volume_manager.btrfs.volumemanagerbtrfs method)": [[26, "kiwi.volume_manager.btrfs.VolumeManagerBtrfs.get_volumes", false]], "get_volumes() (kiwi.volume_manager.lvm.volumemanagerlvm method)": [[26, "kiwi.volume_manager.lvm.VolumeManagerLVM.get_volumes", false]], "get_volumes() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_volumes", false]], "get_xen_hypervisor() (kiwi.system.kernel.kernel method)": [[23, "kiwi.system.kernel.Kernel.get_xen_hypervisor", false]], "get_xsl_stylesheet_file() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_xsl_stylesheet_file", false]], "get_xz_compression_options() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_xz_compression_options", false]], "get_xz_options() (kiwi.runtime_config.runtimeconfig method)": [[1, "kiwi.runtime_config.RuntimeConfig.get_xz_options", false]], "getlogflags() (kiwi.logger.logger method)": [[1, "kiwi.logger.Logger.getLogFlags", false]], "getloglevel() (kiwi.logger.logger method)": [[1, "kiwi.logger.Logger.getLogLevel", false]], "group_add() (kiwi.system.users.users method)": [[23, "kiwi.system.users.Users.group_add", false]], "group_exists() (kiwi.system.users.users method)": [[23, "kiwi.system.users.Users.group_exists", false]], "grub_loader_type (class in kiwi.defaults)": [[1, "kiwi.defaults.grub_loader_type", false]], "guid (kiwi.storage.disk.disk attribute)": [[20, "kiwi.storage.disk.Disk.gUID", false]], "gzip() (kiwi.utils.compress.compress method)": [[25, "kiwi.utils.compress.Compress.gzip", false]], "has_failed() (kiwi.package_manager.base.packagemanagerbase static method)": [[14, "kiwi.package_manager.base.PackageManagerBase.has_failed", false]], "has_failed() (kiwi.package_manager.zypper.packagemanagerzypper static method)": [[14, "kiwi.package_manager.zypper.PackageManagerZypper.has_failed", false]], "has_initrd_support() (kiwi.boot.image.base.bootimagebase static method)": [[4, "kiwi.boot.image.base.BootImageBase.has_initrd_support", false]], "has_initrd_support() (kiwi.boot.image.builtin_kiwi.bootimagekiwi static method)": [[4, "kiwi.boot.image.builtin_kiwi.BootImageKiwi.has_initrd_support", false]], "has_initrd_support() (kiwi.boot.image.dracut.bootimagedracut static method)": [[4, "kiwi.boot.image.dracut.BootImageDracut.has_initrd_support", false]], "has_iso_hybrid_capability() (kiwi.iso_tools.base.isotoolsbase method)": [[13, "kiwi.iso_tools.base.IsoToolsBase.has_iso_hybrid_capability", false]], "has_iso_hybrid_capability() (kiwi.iso_tools.xorriso.isotoolsxorriso method)": [[13, "kiwi.iso_tools.xorriso.IsoToolsXorrIso.has_iso_hybrid_capability", false]], "has_raw_disk() (kiwi.storage.subformat.base.diskformatbase method)": [[21, "kiwi.storage.subformat.base.DiskFormatBase.has_raw_disk", false]], "help (class in kiwi.help)": [[1, "kiwi.help.Help", false]], "history (kiwi.container.oci.ociconfig attribute)": [[10, "kiwi.container.oci.OciConfig.history", false]], "i (kiwi.system.result.result_name_tags attribute)": [[23, "kiwi.system.result.result_name_tags.I", false]], "imagebuilder (class in kiwi.builder)": [[9, "kiwi.builder.ImageBuilder", false]], "import_cdroot_files() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.import_cdroot_files", false]], "import_description() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.import_description", false]], "import_files() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.import_files", false]], "import_image_identifier() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.import_image_identifier", false]], "import_overlay_files() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.import_overlay_files", false]], "import_repositories_marked_as_imageinclude() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.import_repositories_marked_as_imageinclude", false]], "import_system_description_elements() (kiwi.boot.image.base.bootimagebase method)": [[4, "kiwi.boot.image.base.BootImageBase.import_system_description_elements", false]], "import_trusted_keys() (kiwi.repository.base.repositorybase method)": [[16, "kiwi.repository.base.RepositoryBase.import_trusted_keys", false]], "import_trusted_keys() (kiwi.repository.dnf4.repositorydnf4 method)": [[16, "kiwi.repository.dnf4.RepositoryDnf4.import_trusted_keys", false]], "import_trusted_keys() (kiwi.repository.zypper.repositoryzypper method)": [[16, "kiwi.repository.zypper.RepositoryZypper.import_trusted_keys", false]], "include_file() (kiwi.boot.image.base.bootimagebase method)": [[4, "kiwi.boot.image.base.BootImageBase.include_file", false]], "include_file() (kiwi.boot.image.dracut.bootimagedracut method)": [[4, "kiwi.boot.image.dracut.BootImageDracut.include_file", false]], "include_module() (kiwi.boot.image.base.bootimagebase method)": [[4, "kiwi.boot.image.base.BootImageBase.include_module", false]], "include_module() (kiwi.boot.image.dracut.bootimagedracut method)": [[4, "kiwi.boot.image.dracut.BootImageDracut.include_module", false]], "infofilter (class in kiwi.logger_filter)": [[1, "kiwi.logger_filter.InfoFilter", false]], "init_iso_creation_parameters() (kiwi.iso_tools.base.isotoolsbase method)": [[13, "kiwi.iso_tools.base.IsoToolsBase.init_iso_creation_parameters", false]], "init_iso_creation_parameters() (kiwi.iso_tools.xorriso.isotoolsxorriso method)": [[13, "kiwi.iso_tools.xorriso.IsoToolsXorrIso.init_iso_creation_parameters", false]], "initrd_name (kiwi.boot.image.base.boot_names_type attribute)": [[4, "kiwi.boot.image.base.boot_names_type.initrd_name", false]], "install() (kiwi.bootloader.install.base.bootloaderinstallbase method)": [[7, "kiwi.bootloader.install.base.BootLoaderInstallBase.install", false]], "install() (kiwi.bootloader.install.grub2.bootloaderinstallgrub2 method)": [[7, "kiwi.bootloader.install.grub2.BootLoaderInstallGrub2.install", false]], "install_bootstrap() (kiwi.system.prepare.systemprepare method)": [[23, "kiwi.system.prepare.SystemPrepare.install_bootstrap", false]], "install_packages() (kiwi.system.prepare.systemprepare method)": [[23, "kiwi.system.prepare.SystemPrepare.install_packages", false]], "install_required() (kiwi.bootloader.install.base.bootloaderinstallbase method)": [[7, "kiwi.bootloader.install.base.BootLoaderInstallBase.install_required", false]], "install_required() (kiwi.bootloader.install.grub2.bootloaderinstallgrub2 method)": [[7, "kiwi.bootloader.install.grub2.BootLoaderInstallGrub2.install_required", false]], "install_required() (kiwi.bootloader.install.systemd_boot.bootloaderinstallsystemdboot method)": [[7, "kiwi.bootloader.install.systemd_boot.BootLoaderInstallSystemdBoot.install_required", false]], "install_required() (kiwi.bootloader.install.zipl.bootloaderinstallzipl method)": [[7, "kiwi.bootloader.install.zipl.BootLoaderInstallZipl.install_required", false]], "install_system() (kiwi.system.prepare.systemprepare method)": [[23, "kiwi.system.prepare.SystemPrepare.install_system", false]], "installimagebuilder (class in kiwi.builder.install)": [[9, "kiwi.builder.install.InstallImageBuilder", false]], "integrity_root (kiwi.builder.disk.storagemap attribute)": [[9, "kiwi.builder.disk.StorageMap.integrity_root", false]], "is_buildservice_worker() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.is_buildservice_worker", false]], "is_loop() (kiwi.storage.device_provider.deviceprovider method)": [[20, "kiwi.storage.device_provider.DeviceProvider.is_loop", false]], "is_loop() (kiwi.storage.disk.disk method)": [[20, "kiwi.storage.disk.Disk.is_loop", false]], "is_loop() (kiwi.storage.loop_device.loopdevice method)": [[20, "kiwi.storage.loop_device.LoopDevice.is_loop", false]], "is_loop() (kiwi.storage.luks_device.luksdevice method)": [[20, "kiwi.storage.luks_device.LuksDevice.is_loop", false]], "is_loop() (kiwi.storage.mapped_device.mappeddevice method)": [[20, "kiwi.storage.mapped_device.MappedDevice.is_loop", false]], "is_loop() (kiwi.storage.raid_device.raiddevice method)": [[20, "kiwi.storage.raid_device.RaidDevice.is_loop", false]], "is_loop() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.is_loop", false]], "is_mounted() (kiwi.mount_manager.mountmanager method)": [[1, "kiwi.mount_manager.MountManager.is_mounted", false]], "is_obs_public() (kiwi.runtime_config.runtimeconfig method)": [[1, "kiwi.runtime_config.RuntimeConfig.is_obs_public", false]], "is_ppc64_arch() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.is_ppc64_arch", false]], "is_prepared() (kiwi.boot.image.base.bootimagebase method)": [[4, "kiwi.boot.image.base.BootImageBase.is_prepared", false]], "is_public() (kiwi.system.uri.uri method)": [[23, "kiwi.system.uri.Uri.is_public", false]], "is_remote() (kiwi.system.uri.uri method)": [[23, "kiwi.system.uri.Uri.is_remote", false]], "is_root_volume (kiwi.xml_state.volume_type attribute)": [[1, "kiwi.xml_state.volume_type.is_root_volume", false]], "is_uptodate() (kiwi.solver.repository.base.solverrepositorybase method)": [[19, "kiwi.solver.repository.base.SolverRepositoryBase.is_uptodate", false]], "is_x86_arch() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.is_x86_arch", false]], "is_xen_guest() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.is_xen_guest", false]], "is_xen_server() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.is_xen_server", false]], "iso (class in kiwi.iso_tools.iso)": [[13, "kiwi.iso_tools.iso.Iso", false]], "isotools (class in kiwi.iso_tools)": [[13, "kiwi.iso_tools.IsoTools", false]], "isotoolsbase (class in kiwi.iso_tools.base)": [[13, "kiwi.iso_tools.base.IsoToolsBase", false]], "isotoolsxorriso (class in kiwi.iso_tools.xorriso)": [[13, "kiwi.iso_tools.xorriso.IsoToolsXorrIso", false]], "kb (kiwi.defaults.unit_type attribute)": [[1, "kiwi.defaults.unit_type.kb", false]], "kernel (class in kiwi.system.kernel)": [[23, "kiwi.system.kernel.Kernel", false]], "kernel_filename (kiwi.boot.image.base.boot_names_type attribute)": [[4, "kiwi.boot.image.base.boot_names_type.kernel_filename", false]], "kernel_name (kiwi.boot.image.base.boot_names_type attribute)": [[4, "kiwi.boot.image.base.boot_names_type.kernel_name", false]], "kernel_type (class in kiwi.system.kernel)": [[23, "kiwi.system.kernel.kernel_type", false]], "kernel_version (kiwi.boot.image.base.boot_names_type attribute)": [[4, "kiwi.boot.image.base.boot_names_type.kernel_version", false]], "kill() (kiwi.command_process.commanditerator method)": [[1, "kiwi.command_process.CommandIterator.kill", false]], "kisbuilder (class in kiwi.builder.kis)": [[9, "kiwi.builder.kis.KisBuilder", false]], "kiwi": [[1, "module-kiwi", false]], "kiwi.app": [[1, "module-kiwi.app", false]], "kiwi.archive": [[2, "module-kiwi.archive", false]], "kiwi.archive.cpio": [[2, "module-kiwi.archive.cpio", false]], "kiwi.archive.tar": [[2, "module-kiwi.archive.tar", false]], "kiwi.boot": [[3, "module-kiwi.boot", false]], "kiwi.boot.image": [[4, "module-kiwi.boot.image", false]], "kiwi.boot.image.base": [[4, "module-kiwi.boot.image.base", false]], "kiwi.boot.image.builtin_kiwi": [[4, "module-kiwi.boot.image.builtin_kiwi", false]], "kiwi.boot.image.dracut": [[4, "module-kiwi.boot.image.dracut", false]], "kiwi.bootloader": [[5, "module-kiwi.bootloader", false]], "kiwi.bootloader.config": [[6, "module-kiwi.bootloader.config", false]], "kiwi.bootloader.config.base": [[6, "module-kiwi.bootloader.config.base", false]], "kiwi.bootloader.config.grub2": [[6, "module-kiwi.bootloader.config.grub2", false]], "kiwi.bootloader.config.systemd_boot": [[6, "module-kiwi.bootloader.config.systemd_boot", false]], "kiwi.bootloader.config.zipl": [[6, "module-kiwi.bootloader.config.zipl", false]], "kiwi.bootloader.install": [[7, "module-kiwi.bootloader.install", false]], "kiwi.bootloader.install.base": [[7, "module-kiwi.bootloader.install.base", false]], "kiwi.bootloader.install.grub2": [[7, "module-kiwi.bootloader.install.grub2", false]], "kiwi.bootloader.install.systemd_boot": [[7, "module-kiwi.bootloader.install.systemd_boot", false]], "kiwi.bootloader.install.zipl": [[7, "module-kiwi.bootloader.install.zipl", false]], "kiwi.bootloader.template": [[8, "module-kiwi.bootloader.template", false]], "kiwi.bootloader.template.grub2": [[8, "module-kiwi.bootloader.template.grub2", false]], "kiwi.builder": [[9, "module-kiwi.builder", false]], "kiwi.builder.archive": [[9, "module-kiwi.builder.archive", false]], "kiwi.builder.container": [[9, "module-kiwi.builder.container", false]], "kiwi.builder.disk": [[9, "module-kiwi.builder.disk", false]], "kiwi.builder.filesystem": [[9, "module-kiwi.builder.filesystem", false]], "kiwi.builder.install": [[9, "module-kiwi.builder.install", false]], "kiwi.builder.kis": [[9, "module-kiwi.builder.kis", false]], "kiwi.builder.live": [[9, "module-kiwi.builder.live", false]], "kiwi.cli": [[1, "module-kiwi.cli", false]], "kiwi.command": [[1, "module-kiwi.command", false]], "kiwi.command_process": [[1, "module-kiwi.command_process", false]], "kiwi.container": [[10, "module-kiwi.container", false]], "kiwi.container.oci": [[10, "module-kiwi.container.oci", false]], "kiwi.container.setup": [[11, "module-kiwi.container.setup", false]], "kiwi.container.setup.base": [[11, "module-kiwi.container.setup.base", false]], "kiwi.container.setup.docker": [[11, "module-kiwi.container.setup.docker", false]], "kiwi.defaults": [[1, "module-kiwi.defaults", false]], "kiwi.exceptions": [[1, "module-kiwi.exceptions", false]], "kiwi.filesystem": [[12, "module-kiwi.filesystem", false]], "kiwi.filesystem.base": [[12, "module-kiwi.filesystem.base", false]], "kiwi.filesystem.btrfs": [[12, "module-kiwi.filesystem.btrfs", false]], "kiwi.filesystem.ext2": [[12, "module-kiwi.filesystem.ext2", false]], "kiwi.filesystem.ext3": [[12, "module-kiwi.filesystem.ext3", false]], "kiwi.filesystem.ext4": [[12, "module-kiwi.filesystem.ext4", false]], "kiwi.filesystem.fat16": [[12, "module-kiwi.filesystem.fat16", false]], "kiwi.filesystem.fat32": [[12, "module-kiwi.filesystem.fat32", false]], "kiwi.filesystem.isofs": [[12, "module-kiwi.filesystem.isofs", false]], "kiwi.filesystem.setup": [[12, "module-kiwi.filesystem.setup", false]], "kiwi.filesystem.squashfs": [[12, "module-kiwi.filesystem.squashfs", false]], "kiwi.filesystem.xfs": [[12, "module-kiwi.filesystem.xfs", false]], "kiwi.firmware": [[1, "module-kiwi.firmware", false]], "kiwi.help": [[1, "module-kiwi.help", false]], "kiwi.iso_tools": [[13, "module-kiwi.iso_tools", false]], "kiwi.iso_tools.base": [[13, "module-kiwi.iso_tools.base", false]], "kiwi.iso_tools.iso": [[13, "module-kiwi.iso_tools.iso", false]], "kiwi.iso_tools.xorriso": [[13, "module-kiwi.iso_tools.xorriso", false]], "kiwi.kiwi": [[1, "module-kiwi.kiwi", false]], "kiwi.logger": [[1, "module-kiwi.logger", false]], "kiwi.logger_color_formatter": [[1, "module-kiwi.logger_color_formatter", false]], "kiwi.logger_filter": [[1, "module-kiwi.logger_filter", false]], "kiwi.mount_manager": [[1, "module-kiwi.mount_manager", false]], "kiwi.package_manager": [[14, "module-kiwi.package_manager", false]], "kiwi.package_manager.base": [[14, "module-kiwi.package_manager.base", false]], "kiwi.package_manager.dnf4": [[14, "module-kiwi.package_manager.dnf4", false]], "kiwi.package_manager.zypper": [[14, "module-kiwi.package_manager.zypper", false]], "kiwi.partitioner": [[15, "module-kiwi.partitioner", false]], "kiwi.partitioner.base": [[15, "module-kiwi.partitioner.base", false]], "kiwi.partitioner.dasd": [[15, "module-kiwi.partitioner.dasd", false]], "kiwi.partitioner.gpt": [[15, "module-kiwi.partitioner.gpt", false]], "kiwi.partitioner.msdos": [[15, "module-kiwi.partitioner.msdos", false]], "kiwi.path": [[1, "module-kiwi.path", false]], "kiwi.privileges": [[1, "module-kiwi.privileges", false]], "kiwi.repository": [[16, "module-kiwi.repository", false]], "kiwi.repository.base": [[16, "module-kiwi.repository.base", false]], "kiwi.repository.dnf4": [[16, "module-kiwi.repository.dnf4", false]], "kiwi.repository.template": [[17, "module-kiwi.repository.template", false]], "kiwi.repository.template.apt": [[17, "module-kiwi.repository.template.apt", false]], "kiwi.repository.zypper": [[16, "module-kiwi.repository.zypper", false]], "kiwi.runtime_checker": [[1, "module-kiwi.runtime_checker", false]], "kiwi.runtime_config": [[1, "module-kiwi.runtime_config", false]], "kiwi.solver": [[18, "module-kiwi.solver", false]], "kiwi.solver.repository": [[19, "module-kiwi.solver.repository", false]], "kiwi.solver.repository.base": [[19, "module-kiwi.solver.repository.base", false]], "kiwi.solver.repository.rpm_dir": [[19, "module-kiwi.solver.repository.rpm_dir", false]], "kiwi.solver.repository.rpm_md": [[19, "module-kiwi.solver.repository.rpm_md", false]], "kiwi.solver.repository.suse": [[19, "module-kiwi.solver.repository.suse", false]], "kiwi.solver.sat": [[18, "module-kiwi.solver.sat", false]], "kiwi.storage": [[20, "module-kiwi.storage", false]], "kiwi.storage.clone_device": [[20, "module-kiwi.storage.clone_device", false]], "kiwi.storage.device_provider": [[20, "module-kiwi.storage.device_provider", false]], "kiwi.storage.disk": [[20, "module-kiwi.storage.disk", false]], "kiwi.storage.loop_device": [[20, "module-kiwi.storage.loop_device", false]], "kiwi.storage.luks_device": [[20, "module-kiwi.storage.luks_device", false]], "kiwi.storage.mapped_device": [[20, "module-kiwi.storage.mapped_device", false]], "kiwi.storage.raid_device": [[20, "module-kiwi.storage.raid_device", false]], "kiwi.storage.setup": [[20, "module-kiwi.storage.setup", false]], "kiwi.storage.subformat": [[21, "module-kiwi.storage.subformat", false]], "kiwi.storage.subformat.base": [[21, "module-kiwi.storage.subformat.base", false]], "kiwi.storage.subformat.gce": [[21, "module-kiwi.storage.subformat.gce", false]], "kiwi.storage.subformat.ova": [[21, "module-kiwi.storage.subformat.ova", false]], "kiwi.storage.subformat.qcow2": [[21, "module-kiwi.storage.subformat.qcow2", false]], "kiwi.storage.subformat.template": [[22, "module-kiwi.storage.subformat.template", false]], "kiwi.storage.subformat.template.vagrant_config": [[22, "module-kiwi.storage.subformat.template.vagrant_config", false]], "kiwi.storage.subformat.template.virtualbox_ovf": [[22, "module-kiwi.storage.subformat.template.virtualbox_ovf", false]], "kiwi.storage.subformat.template.vmware_settings": [[22, "module-kiwi.storage.subformat.template.vmware_settings", false]], "kiwi.storage.subformat.vagrant_base": [[21, "module-kiwi.storage.subformat.vagrant_base", false]], "kiwi.storage.subformat.vagrant_libvirt": [[21, "module-kiwi.storage.subformat.vagrant_libvirt", false]], "kiwi.storage.subformat.vagrant_virtualbox": [[21, "module-kiwi.storage.subformat.vagrant_virtualbox", false]], "kiwi.storage.subformat.vdi": [[21, "module-kiwi.storage.subformat.vdi", false]], "kiwi.storage.subformat.vhd": [[21, "module-kiwi.storage.subformat.vhd", false]], "kiwi.storage.subformat.vhdfixed": [[21, "module-kiwi.storage.subformat.vhdfixed", false]], "kiwi.storage.subformat.vhdx": [[21, "module-kiwi.storage.subformat.vhdx", false]], "kiwi.storage.subformat.vmdk": [[21, "module-kiwi.storage.subformat.vmdk", false]], "kiwi.system": [[23, "module-kiwi.system", false]], "kiwi.system.identifier": [[23, "module-kiwi.system.identifier", false]], "kiwi.system.kernel": [[23, "module-kiwi.system.kernel", false]], "kiwi.system.prepare": [[23, "module-kiwi.system.prepare", false]], "kiwi.system.profile": [[23, "module-kiwi.system.profile", false]], "kiwi.system.result": [[23, "module-kiwi.system.result", false]], "kiwi.system.root_bind": [[23, "module-kiwi.system.root_bind", false]], "kiwi.system.root_init": [[23, "module-kiwi.system.root_init", false]], "kiwi.system.setup": [[23, "module-kiwi.system.setup", false]], "kiwi.system.shell": [[23, "module-kiwi.system.shell", false]], "kiwi.system.size": [[23, "module-kiwi.system.size", false]], "kiwi.system.uri": [[23, "module-kiwi.system.uri", false]], "kiwi.system.users": [[23, "module-kiwi.system.users", false]], "kiwi.tasks": [[24, "module-kiwi.tasks", false]], "kiwi.tasks.base": [[24, "module-kiwi.tasks.base", false]], "kiwi.tasks.result_bundle": [[24, "module-kiwi.tasks.result_bundle", false]], "kiwi.tasks.result_list": [[24, "module-kiwi.tasks.result_list", false]], "kiwi.tasks.system_build": [[24, "module-kiwi.tasks.system_build", false]], "kiwi.tasks.system_create": [[24, "module-kiwi.tasks.system_create", false]], "kiwi.tasks.system_prepare": [[24, "module-kiwi.tasks.system_prepare", false]], "kiwi.tasks.system_update": [[24, "module-kiwi.tasks.system_update", false]], "kiwi.utils": [[25, "module-kiwi.utils", false]], "kiwi.utils.block": [[25, "module-kiwi.utils.block", false]], "kiwi.utils.checksum": [[25, "module-kiwi.utils.checksum", false]], "kiwi.utils.compress": [[25, "module-kiwi.utils.compress", false]], "kiwi.utils.sync": [[25, "module-kiwi.utils.sync", false]], "kiwi.utils.sysconfig": [[25, "module-kiwi.utils.sysconfig", false]], "kiwi.version": [[1, "module-kiwi.version", false]], "kiwi.volume_manager": [[26, "module-kiwi.volume_manager", false]], "kiwi.volume_manager.base": [[26, "module-kiwi.volume_manager.base", false]], "kiwi.volume_manager.btrfs": [[26, "module-kiwi.volume_manager.btrfs", false]], "kiwi.volume_manager.lvm": [[26, "module-kiwi.volume_manager.lvm", false]], "kiwi.xml_description": [[1, "module-kiwi.xml_description", false]], "kiwi.xml_state": [[1, "module-kiwi.xml_state", false]], "kiwianymarkuppluginerror": [[1, "kiwi.exceptions.KiwiAnyMarkupPluginError", false]], "kiwiarchivesetuperror": [[1, "kiwi.exceptions.KiwiArchiveSetupError", false]], "kiwiarchivetarerror": [[1, "kiwi.exceptions.KiwiArchiveTarError", false]], "kiwibootimagesetuperror": [[1, "kiwi.exceptions.KiwiBootImageSetupError", false]], "kiwibootloaderconfigsetuperror": [[1, "kiwi.exceptions.KiwiBootLoaderConfigSetupError", false]], "kiwibootloaderdiskpassworderror": [[1, "kiwi.exceptions.KiwiBootLoaderDiskPasswordError", false]], "kiwibootloadergrubdataerror": [[1, "kiwi.exceptions.KiwiBootLoaderGrubDataError", false]], "kiwibootloadergrubfonterror": [[1, "kiwi.exceptions.KiwiBootLoaderGrubFontError", false]], "kiwibootloadergrubinstallerror": [[1, "kiwi.exceptions.KiwiBootLoaderGrubInstallError", false]], "kiwibootloadergrubmoduleserror": [[1, "kiwi.exceptions.KiwiBootLoaderGrubModulesError", false]], "kiwibootloadergrubplatformerror": [[1, "kiwi.exceptions.KiwiBootLoaderGrubPlatformError", false]], "kiwibootloadergrubsecurebooterror": [[1, "kiwi.exceptions.KiwiBootLoaderGrubSecureBootError", false]], "kiwibootloaderinstallsetuperror": [[1, "kiwi.exceptions.KiwiBootLoaderInstallSetupError", false]], "kiwibootloadertargeterror": [[1, "kiwi.exceptions.KiwiBootLoaderTargetError", false]], "kiwibootloaderziplinstallerror": [[1, "kiwi.exceptions.KiwiBootLoaderZiplInstallError", false]], "kiwibootloaderziplplatformerror": [[1, "kiwi.exceptions.KiwiBootLoaderZiplPlatformError", false]], "kiwibootloaderziplsetuperror": [[1, "kiwi.exceptions.KiwiBootLoaderZiplSetupError", false]], "kiwibootstrapphasefailed": [[1, "kiwi.exceptions.KiwiBootStrapPhaseFailed", false]], "kiwibuildaherror": [[1, "kiwi.exceptions.KiwiBuildahError", false]], "kiwibundleerror": [[1, "kiwi.exceptions.KiwiBundleError", false]], "kiwicommandcapabilitieserror": [[1, "kiwi.exceptions.KiwiCommandCapabilitiesError", false]], "kiwicommanderror": [[1, "kiwi.exceptions.KiwiCommandError", false]], "kiwicommandnotfound": [[1, "kiwi.exceptions.KiwiCommandNotFound", false]], "kiwicommandnotloaded": [[1, "kiwi.exceptions.KiwiCommandNotLoaded", false]], "kiwicompressionformatunknown": [[1, "kiwi.exceptions.KiwiCompressionFormatUnknown", false]], "kiwiconfigfileformatnotsupported": [[1, "kiwi.exceptions.KiwiConfigFileFormatNotSupported", false]], "kiwiconfigfilenotfound": [[1, "kiwi.exceptions.KiwiConfigFileNotFound", false]], "kiwicontainerbuildererror": [[1, "kiwi.exceptions.KiwiContainerBuilderError", false]], "kiwicontainerimagesetuperror": [[1, "kiwi.exceptions.KiwiContainerImageSetupError", false]], "kiwicontainersetuperror": [[1, "kiwi.exceptions.KiwiContainerSetupError", false]], "kiwicredentialserror": [[1, "kiwi.exceptions.KiwiCredentialsError", false]], "kiwicustompartitionconflicterror": [[1, "kiwi.exceptions.KiwiCustomPartitionConflictError", false]], "kiwidatastructureerror": [[1, "kiwi.exceptions.KiwiDataStructureError", false]], "kiwidebianbootstraperror": [[1, "kiwi.exceptions.KiwiDebianBootstrapError", false]], "kiwidecodingerror": [[1, "kiwi.exceptions.KiwiDecodingError", false]], "kiwidescriptioninvalid": [[1, "kiwi.exceptions.KiwiDescriptionInvalid", false]], "kiwideviceprovidererror": [[1, "kiwi.exceptions.KiwiDeviceProviderError", false]], "kiwidiskbootimageerror": [[1, "kiwi.exceptions.KiwiDiskBootImageError", false]], "kiwidiskformatsetuperror": [[1, "kiwi.exceptions.KiwiDiskFormatSetupError", false]], "kiwidiskgeometryerror": [[1, "kiwi.exceptions.KiwiDiskGeometryError", false]], "kiwidistributionnameerror": [[1, "kiwi.exceptions.KiwiDistributionNameError", false]], "kiwienclavebootimageerror": [[1, "kiwi.exceptions.KiwiEnclaveBootImageError", false]], "kiwienclaveformaterror": [[1, "kiwi.exceptions.KiwiEnclaveFormatError", false]], "kiwierror": [[1, "kiwi.exceptions.KiwiError", false]], "kiwiextensionerror": [[1, "kiwi.exceptions.KiwiExtensionError", false]], "kiwifileaccesserror": [[1, "kiwi.exceptions.KiwiFileAccessError", false]], "kiwifilenotfound": [[1, "kiwi.exceptions.KiwiFileNotFound", false]], "kiwifilesystemsetuperror": [[1, "kiwi.exceptions.KiwiFileSystemSetupError", false]], "kiwifilesystemsyncerror": [[1, "kiwi.exceptions.KiwiFileSystemSyncError", false]], "kiwiformatsetuperror": [[1, "kiwi.exceptions.KiwiFormatSetupError", false]], "kiwihelpnocommandgiven": [[1, "kiwi.exceptions.KiwiHelpNoCommandGiven", false]], "kiwiimageresizeerror": [[1, "kiwi.exceptions.KiwiImageResizeError", false]], "kiwiimportdescriptionerror": [[1, "kiwi.exceptions.KiwiImportDescriptionError", false]], "kiwiincludfilenotfounderror": [[1, "kiwi.exceptions.KiwiIncludFileNotFoundError", false]], "kiwiinstallbootimageerror": [[1, "kiwi.exceptions.KiwiInstallBootImageError", false]], "kiwiinstallmediaerror": [[1, "kiwi.exceptions.KiwiInstallMediaError", false]], "kiwiinstallphasefailed": [[1, "kiwi.exceptions.KiwiInstallPhaseFailed", false]], "kiwiisometadataerror": [[1, "kiwi.exceptions.KiwiIsoMetaDataError", false]], "kiwiisotoolerror": [[1, "kiwi.exceptions.KiwiIsoToolError", false]], "kiwikernellookuperror": [[1, "kiwi.exceptions.KiwiKernelLookupError", false]], "kiwikisbootimageerror": [[1, "kiwi.exceptions.KiwiKisBootImageError", false]], "kiwilivebootimageerror": [[1, "kiwi.exceptions.KiwiLiveBootImageError", false]], "kiwiloadcommandundefined": [[1, "kiwi.exceptions.KiwiLoadCommandUndefined", false]], "kiwilogfilesetupfailed": [[1, "kiwi.exceptions.KiwiLogFileSetupFailed", false]], "kiwilogsocketsetupfailed": [[1, "kiwi.exceptions.KiwiLogSocketSetupFailed", false]], "kiwiloopsetuperror": [[1, "kiwi.exceptions.KiwiLoopSetupError", false]], "kiwilukssetuperror": [[1, "kiwi.exceptions.KiwiLuksSetupError", false]], "kiwimappeddeviceerror": [[1, "kiwi.exceptions.KiwiMappedDeviceError", false]], "kiwimarkupconversionerror": [[1, "kiwi.exceptions.KiwiMarkupConversionError", false]], "kiwimountkernelfilesystemserror": [[1, "kiwi.exceptions.KiwiMountKernelFileSystemsError", false]], "kiwimountshareddirectoryerror": [[1, "kiwi.exceptions.KiwiMountSharedDirectoryError", false]], "kiwinotimplementederror": [[1, "kiwi.exceptions.KiwiNotImplementedError", false]], "kiwiociarchivetoolerror": [[1, "kiwi.exceptions.KiwiOCIArchiveToolError", false]], "kiwioffseterror": [[1, "kiwi.exceptions.KiwiOffsetError", false]], "kiwiosreleaseimporterror": [[1, "kiwi.exceptions.KiwiOSReleaseImportError", false]], "kiwipackagemanagersetuperror": [[1, "kiwi.exceptions.KiwiPackageManagerSetupError", false]], "kiwipackagesdeletephasefailed": [[1, "kiwi.exceptions.KiwiPackagesDeletePhaseFailed", false]], "kiwipartitionergptflagerror": [[1, "kiwi.exceptions.KiwiPartitionerGptFlagError", false]], "kiwipartitionermsdosflagerror": [[1, "kiwi.exceptions.KiwiPartitionerMsDosFlagError", false]], "kiwipartitionersetuperror": [[1, "kiwi.exceptions.KiwiPartitionerSetupError", false]], "kiwipartitiontoosmallerror": [[1, "kiwi.exceptions.KiwiPartitionTooSmallError", false]], "kiwiprivilegeserror": [[1, "kiwi.exceptions.KiwiPrivilegesError", false]], "kiwiprofilenotfound": [[1, "kiwi.exceptions.KiwiProfileNotFound", false]], "kiwiraidsetuperror": [[1, "kiwi.exceptions.KiwiRaidSetupError", false]], "kiwirepositorysetuperror": [[1, "kiwi.exceptions.KiwiRepositorySetupError", false]], "kiwirequestedtypeerror": [[1, "kiwi.exceptions.KiwiRequestedTypeError", false]], "kiwirequesterror": [[1, "kiwi.exceptions.KiwiRequestError", false]], "kiwiresizerawdiskerror": [[1, "kiwi.exceptions.KiwiResizeRawDiskError", false]], "kiwiresulterror": [[1, "kiwi.exceptions.KiwiResultError", false]], "kiwirootdirexists": [[1, "kiwi.exceptions.KiwiRootDirExists", false]], "kiwirootimporterror": [[1, "kiwi.exceptions.KiwiRootImportError", false]], "kiwirootinitcreationerror": [[1, "kiwi.exceptions.KiwiRootInitCreationError", false]], "kiwirpmdirnotremoteerror": [[1, "kiwi.exceptions.KiwiRpmDirNotRemoteError", false]], "kiwiruntimeconfigfileerror": [[1, "kiwi.exceptions.KiwiRuntimeConfigFileError", false]], "kiwiruntimeconfigformaterror": [[1, "kiwi.exceptions.KiwiRuntimeConfigFormatError", false]], "kiwiruntimeerror": [[1, "kiwi.exceptions.KiwiRuntimeError", false]], "kiwisatsolverjoberror": [[1, "kiwi.exceptions.KiwiSatSolverJobError", false]], "kiwisatsolverjobproblems": [[1, "kiwi.exceptions.KiwiSatSolverJobProblems", false]], "kiwisatsolverpluginerror": [[1, "kiwi.exceptions.KiwiSatSolverPluginError", false]], "kiwischemaimporterror": [[1, "kiwi.exceptions.KiwiSchemaImportError", false]], "kiwiscriptfailed": [[1, "kiwi.exceptions.KiwiScriptFailed", false]], "kiwisetupintermediateconfigerror": [[1, "kiwi.exceptions.KiwiSetupIntermediateConfigError", false]], "kiwishellvariablevalueerror": [[1, "kiwi.exceptions.KiwiShellVariableValueError", false]], "kiwisizeerror": [[1, "kiwi.exceptions.KiwiSizeError", false]], "kiwisolverrepositorysetuperror": [[1, "kiwi.exceptions.KiwiSolverRepositorySetupError", false]], "kiwisystemdeletepackagesfailed": [[1, "kiwi.exceptions.KiwiSystemDeletePackagesFailed", false]], "kiwisysteminstallpackagesfailed": [[1, "kiwi.exceptions.KiwiSystemInstallPackagesFailed", false]], "kiwisystemupdatefailed": [[1, "kiwi.exceptions.KiwiSystemUpdateFailed", false]], "kiwitargetdirectorynotfound": [[1, "kiwi.exceptions.KiwiTargetDirectoryNotFound", false]], "kiwitemplateerror": [[1, "kiwi.exceptions.KiwiTemplateError", false]], "kiwitypenotfound": [[1, "kiwi.exceptions.KiwiTypeNotFound", false]], "kiwiumountbusyerror": [[1, "kiwi.exceptions.KiwiUmountBusyError", false]], "kiwiunknownservicename": [[1, "kiwi.exceptions.KiwiUnknownServiceName", false]], "kiwiuriopenerror": [[1, "kiwi.exceptions.KiwiUriOpenError", false]], "kiwiuristyleunknown": [[1, "kiwi.exceptions.KiwiUriStyleUnknown", false]], "kiwiuritypeunknown": [[1, "kiwi.exceptions.KiwiUriTypeUnknown", false]], "kiwivalidationerror": [[1, "kiwi.exceptions.KiwiValidationError", false]], "kiwivhdtagerror": [[1, "kiwi.exceptions.KiwiVhdTagError", false]], "kiwivolumegroupconflict": [[1, "kiwi.exceptions.KiwiVolumeGroupConflict", false]], "kiwivolumemanagersetuperror": [[1, "kiwi.exceptions.KiwiVolumeManagerSetupError", false]], "kiwivolumerootiderror": [[1, "kiwi.exceptions.KiwiVolumeRootIDError", false]], "kiwivolumetoosmallerror": [[1, "kiwi.exceptions.KiwiVolumeTooSmallError", false]], "label (kiwi.xml_state.volume_type attribute)": [[1, "kiwi.xml_state.volume_type.label", false]], "labels (kiwi.container.oci.ociconfig attribute)": [[10, "kiwi.container.oci.OciConfig.labels", false]], "legacy_bios_mode() (kiwi.firmware.firmware method)": [[1, "kiwi.firmware.FirmWare.legacy_bios_mode", false]], "list_iso() (kiwi.iso_tools.base.isotoolsbase method)": [[13, "kiwi.iso_tools.base.IsoToolsBase.list_iso", false]], "liveimagebuilder (class in kiwi.builder.live)": [[9, "kiwi.builder.live.LiveImageBuilder", false]], "load() (kiwi.system.result.result static method)": [[23, "kiwi.system.result.Result.load", false]], "load() (kiwi.xml_description.xmldescription method)": [[1, "kiwi.xml_description.XMLDescription.load", false]], "load_boot_xml_description() (kiwi.boot.image.base.bootimagebase method)": [[4, "kiwi.boot.image.base.BootImageBase.load_boot_xml_description", false]], "load_command (kiwi.xml_state.containert attribute)": [[1, "kiwi.xml_state.ContainerT.load_command", false]], "load_command() (kiwi.cli.cli method)": [[1, "kiwi.cli.Cli.load_command", false]], "load_xml_description() (kiwi.tasks.base.clitask method)": [[24, "kiwi.tasks.base.CliTask.load_xml_description", false]], "logger (class in kiwi.logger)": [[1, "kiwi.logger.Logger", false]], "loggerschedulerfilter (class in kiwi.logger_filter)": [[1, "kiwi.logger_filter.LoggerSchedulerFilter", false]], "loopdevice (class in kiwi.storage.loop_device)": [[20, "kiwi.storage.loop_device.LoopDevice", false]], "luks_root (kiwi.builder.disk.storagemap attribute)": [[9, "kiwi.builder.disk.StorageMap.luks_root", false]], "luksdevice (class in kiwi.storage.luks_device)": [[20, "kiwi.storage.luks_device.LuksDevice", false]], "m (kiwi.system.result.result_name_tags attribute)": [[23, "kiwi.system.result.result_name_tags.M", false], [23, "kiwi.system.result.result_name_tags.m", false]], "main() (in module kiwi.kiwi)": [[1, "kiwi.kiwi.main", false]], "maintainer (kiwi.container.oci.ociconfig attribute)": [[10, "kiwi.container.oci.OciConfig.maintainer", false]], "map_partitions() (kiwi.storage.disk.disk method)": [[20, "kiwi.storage.disk.Disk.map_partitions", false]], "mappeddevice (class in kiwi.storage.mapped_device)": [[20, "kiwi.storage.mapped_device.MappedDevice", false]], "match_package_deleted() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.match_package_deleted", false]], "match_package_deleted() (kiwi.package_manager.dnf4.packagemanagerdnf4 method)": [[14, "kiwi.package_manager.dnf4.PackageManagerDnf4.match_package_deleted", false]], "match_package_deleted() (kiwi.package_manager.zypper.packagemanagerzypper method)": [[14, "kiwi.package_manager.zypper.PackageManagerZypper.match_package_deleted", false]], "match_package_installed() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.match_package_installed", false]], "match_package_installed() (kiwi.package_manager.dnf4.packagemanagerdnf4 method)": [[14, "kiwi.package_manager.dnf4.PackageManagerDnf4.match_package_installed", false]], "match_package_installed() (kiwi.package_manager.zypper.packagemanagerzypper method)": [[14, "kiwi.package_manager.zypper.PackageManagerZypper.match_package_installed", false]], "matches() (kiwi.utils.checksum.checksum method)": [[25, "kiwi.utils.checksum.Checksum.matches", false]], "mb (kiwi.defaults.unit_type attribute)": [[1, "kiwi.defaults.unit_type.mb", false]], "mbsize (kiwi.storage.disk.ptable_entry_type attribute)": [[20, "kiwi.storage.disk.ptable_entry_type.mbsize", false]], "mbytes (kiwi.xml_state.size_type attribute)": [[1, "kiwi.xml_state.size_type.mbytes", false]], "md5() (kiwi.utils.checksum.checksum method)": [[25, "kiwi.utils.checksum.Checksum.md5", false]], "min_version (kiwi.runtime_checker.dracut_module_type attribute)": [[1, "kiwi.runtime_checker.dracut_module_type.min_version", false]], "module": [[1, "module-kiwi", false], [1, "module-kiwi.app", false], [1, "module-kiwi.cli", false], [1, "module-kiwi.command", false], [1, "module-kiwi.command_process", false], [1, "module-kiwi.defaults", false], [1, "module-kiwi.exceptions", false], [1, "module-kiwi.firmware", false], [1, "module-kiwi.help", false], [1, "module-kiwi.kiwi", false], [1, "module-kiwi.logger", false], [1, "module-kiwi.logger_color_formatter", false], [1, "module-kiwi.logger_filter", false], [1, "module-kiwi.mount_manager", false], [1, "module-kiwi.path", false], [1, "module-kiwi.privileges", false], [1, "module-kiwi.runtime_checker", false], [1, "module-kiwi.runtime_config", false], [1, "module-kiwi.version", false], [1, "module-kiwi.xml_description", false], [1, "module-kiwi.xml_state", false], [2, "module-kiwi.archive", false], [2, "module-kiwi.archive.cpio", false], [2, "module-kiwi.archive.tar", false], [3, "module-kiwi.boot", false], [4, "module-kiwi.boot.image", false], [4, "module-kiwi.boot.image.base", false], [4, "module-kiwi.boot.image.builtin_kiwi", false], [4, "module-kiwi.boot.image.dracut", false], [5, "module-kiwi.bootloader", false], [6, "module-kiwi.bootloader.config", false], [6, "module-kiwi.bootloader.config.base", false], [6, "module-kiwi.bootloader.config.grub2", false], [6, "module-kiwi.bootloader.config.systemd_boot", false], [6, "module-kiwi.bootloader.config.zipl", false], [7, "module-kiwi.bootloader.install", false], [7, "module-kiwi.bootloader.install.base", false], [7, "module-kiwi.bootloader.install.grub2", false], [7, "module-kiwi.bootloader.install.systemd_boot", false], [7, "module-kiwi.bootloader.install.zipl", false], [8, "module-kiwi.bootloader.template", false], [8, "module-kiwi.bootloader.template.grub2", false], [9, "module-kiwi.builder", false], [9, "module-kiwi.builder.archive", false], [9, "module-kiwi.builder.container", false], [9, "module-kiwi.builder.disk", false], [9, "module-kiwi.builder.filesystem", false], [9, "module-kiwi.builder.install", false], [9, "module-kiwi.builder.kis", false], [9, "module-kiwi.builder.live", false], [10, "module-kiwi.container", false], [10, "module-kiwi.container.oci", false], [11, "module-kiwi.container.setup", false], [11, "module-kiwi.container.setup.base", false], [11, "module-kiwi.container.setup.docker", false], [12, "module-kiwi.filesystem", false], [12, "module-kiwi.filesystem.base", false], [12, "module-kiwi.filesystem.btrfs", false], [12, "module-kiwi.filesystem.ext2", false], [12, "module-kiwi.filesystem.ext3", false], [12, "module-kiwi.filesystem.ext4", false], [12, "module-kiwi.filesystem.fat16", false], [12, "module-kiwi.filesystem.fat32", false], [12, "module-kiwi.filesystem.isofs", false], [12, "module-kiwi.filesystem.setup", false], [12, "module-kiwi.filesystem.squashfs", false], [12, "module-kiwi.filesystem.xfs", false], [13, "module-kiwi.iso_tools", false], [13, "module-kiwi.iso_tools.base", false], [13, "module-kiwi.iso_tools.iso", false], [13, "module-kiwi.iso_tools.xorriso", false], [14, "module-kiwi.package_manager", false], [14, "module-kiwi.package_manager.base", false], [14, "module-kiwi.package_manager.dnf4", false], [14, "module-kiwi.package_manager.zypper", false], [15, "module-kiwi.partitioner", false], [15, "module-kiwi.partitioner.base", false], [15, "module-kiwi.partitioner.dasd", false], [15, "module-kiwi.partitioner.gpt", false], [15, "module-kiwi.partitioner.msdos", false], [16, "module-kiwi.repository", false], [16, "module-kiwi.repository.base", false], [16, "module-kiwi.repository.dnf4", false], [16, "module-kiwi.repository.zypper", false], [17, "module-kiwi.repository.template", false], [17, "module-kiwi.repository.template.apt", false], [18, "module-kiwi.solver", false], [18, "module-kiwi.solver.sat", false], [19, "module-kiwi.solver.repository", false], [19, "module-kiwi.solver.repository.base", false], [19, "module-kiwi.solver.repository.rpm_dir", false], [19, "module-kiwi.solver.repository.rpm_md", false], [19, "module-kiwi.solver.repository.suse", false], [20, "module-kiwi.storage", false], [20, "module-kiwi.storage.clone_device", false], [20, "module-kiwi.storage.device_provider", false], [20, "module-kiwi.storage.disk", false], [20, "module-kiwi.storage.loop_device", false], [20, "module-kiwi.storage.luks_device", false], [20, "module-kiwi.storage.mapped_device", false], [20, "module-kiwi.storage.raid_device", false], [20, "module-kiwi.storage.setup", false], [21, "module-kiwi.storage.subformat", false], [21, "module-kiwi.storage.subformat.base", false], [21, "module-kiwi.storage.subformat.gce", false], [21, "module-kiwi.storage.subformat.ova", false], [21, "module-kiwi.storage.subformat.qcow2", false], [21, "module-kiwi.storage.subformat.vagrant_base", false], [21, "module-kiwi.storage.subformat.vagrant_libvirt", false], [21, "module-kiwi.storage.subformat.vagrant_virtualbox", false], [21, "module-kiwi.storage.subformat.vdi", false], [21, "module-kiwi.storage.subformat.vhd", false], [21, "module-kiwi.storage.subformat.vhdfixed", false], [21, "module-kiwi.storage.subformat.vhdx", false], [21, "module-kiwi.storage.subformat.vmdk", false], [22, "module-kiwi.storage.subformat.template", false], [22, "module-kiwi.storage.subformat.template.vagrant_config", false], [22, "module-kiwi.storage.subformat.template.virtualbox_ovf", false], [22, "module-kiwi.storage.subformat.template.vmware_settings", false], [23, "module-kiwi.system", false], [23, "module-kiwi.system.identifier", false], [23, "module-kiwi.system.kernel", false], [23, "module-kiwi.system.prepare", false], [23, "module-kiwi.system.profile", false], [23, "module-kiwi.system.result", false], [23, "module-kiwi.system.root_bind", false], [23, "module-kiwi.system.root_init", false], [23, "module-kiwi.system.setup", false], [23, "module-kiwi.system.shell", false], [23, "module-kiwi.system.size", false], [23, "module-kiwi.system.uri", false], [23, "module-kiwi.system.users", false], [24, "module-kiwi.tasks", false], [24, "module-kiwi.tasks.base", false], [24, "module-kiwi.tasks.result_bundle", false], [24, "module-kiwi.tasks.result_list", false], [24, "module-kiwi.tasks.system_build", false], [24, "module-kiwi.tasks.system_create", false], [24, "module-kiwi.tasks.system_prepare", false], [24, "module-kiwi.tasks.system_update", false], [25, "module-kiwi.utils", false], [25, "module-kiwi.utils.block", false], [25, "module-kiwi.utils.checksum", false], [25, "module-kiwi.utils.compress", false], [25, "module-kiwi.utils.sync", false], [25, "module-kiwi.utils.sysconfig", false], [26, "module-kiwi.volume_manager", false], [26, "module-kiwi.volume_manager.base", false], [26, "module-kiwi.volume_manager.btrfs", false], [26, "module-kiwi.volume_manager.lvm", false]], "mount() (kiwi.filesystem.base.filesystembase method)": [[12, "kiwi.filesystem.base.FileSystemBase.mount", false]], "mount() (kiwi.mount_manager.mountmanager method)": [[1, "kiwi.mount_manager.MountManager.mount", false]], "mount() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.mount", false]], "mount_kernel_file_systems() (kiwi.system.root_bind.rootbind method)": [[23, "kiwi.system.root_bind.RootBind.mount_kernel_file_systems", false]], "mount_list (kiwi.volume_manager.base.volumemanagerbase attribute)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.mount_list", false]], "mount_shared_directory() (kiwi.system.root_bind.rootbind method)": [[23, "kiwi.system.root_bind.RootBind.mount_shared_directory", false]], "mount_volumes() (kiwi.filesystem.base.filesystembase method)": [[12, "kiwi.filesystem.base.FileSystemBase.mount_volumes", false]], "mount_volumes() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.mount_volumes", false]], "mount_volumes() (kiwi.volume_manager.btrfs.volumemanagerbtrfs method)": [[26, "kiwi.volume_manager.btrfs.VolumeManagerBtrfs.mount_volumes", false]], "mount_volumes() (kiwi.volume_manager.lvm.volumemanagerlvm method)": [[26, "kiwi.volume_manager.lvm.VolumeManagerLVM.mount_volumes", false]], "mountmanager (class in kiwi.mount_manager)": [[1, "kiwi.mount_manager.MountManager", false]], "mountpoint (kiwi.storage.disk.ptable_entry_type attribute)": [[20, "kiwi.storage.disk.ptable_entry_type.mountpoint", false]], "mountpoint (kiwi.volume_manager.base.volumemanagerbase attribute)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.mountpoint", false]], "mountpoint (kiwi.xml_state.volume_type attribute)": [[1, "kiwi.xml_state.volume_type.mountpoint", false]], "move_to_root() (kiwi.path.path static method)": [[1, "kiwi.path.Path.move_to_root", false]], "n (kiwi.system.result.result_name_tags attribute)": [[23, "kiwi.system.result.result_name_tags.N", false]], "name (kiwi.system.kernel.kernel_type attribute)": [[23, "kiwi.system.kernel.kernel_type.name", false]], "name (kiwi.system.kernel.xen_hypervisor_type attribute)": [[23, "kiwi.system.kernel.xen_hypervisor_type.name", false]], "name (kiwi.xml_state.containert attribute)": [[1, "kiwi.xml_state.ContainerT.name", false]], "name (kiwi.xml_state.volume_type attribute)": [[1, "kiwi.xml_state.volume_type.name", false]], "need_boot_partition() (kiwi.storage.setup.disksetup method)": [[20, "kiwi.storage.setup.DiskSetup.need_boot_partition", false]], "new() (kiwi.boot.image.bootimage static method)": [[4, "kiwi.boot.image.BootImage.new", false]], "new() (kiwi.bootloader.install.bootloaderinstall static method)": [[7, "kiwi.bootloader.install.BootLoaderInstall.new", false]], "new() (kiwi.builder.imagebuilder static method)": [[9, "kiwi.builder.ImageBuilder.new", false]], "new() (kiwi.container.containerimage static method)": [[10, "kiwi.container.ContainerImage.new", false]], "new() (kiwi.container.setup.containersetup static method)": [[11, "kiwi.container.setup.ContainerSetup.new", false]], "new() (kiwi.filesystem.filesystem static method)": [[12, "kiwi.filesystem.FileSystem.new", false]], "new() (kiwi.iso_tools.isotools static method)": [[13, "kiwi.iso_tools.IsoTools.new", false]], "new() (kiwi.package_manager.packagemanager static method)": [[14, "kiwi.package_manager.PackageManager.new", false]], "new() (kiwi.partitioner.partitioner static method)": [[15, "kiwi.partitioner.Partitioner.new", false]], "new() (kiwi.repository.repository static method)": [[16, "kiwi.repository.Repository.new", false]], "new() (kiwi.solver.repository.solverrepository static method)": [[19, "kiwi.solver.repository.SolverRepository.new", false]], "new() (kiwi.storage.subformat.diskformat static method)": [[21, "kiwi.storage.subformat.DiskFormat.new", false]], "new() (kiwi.volume_manager.volumemanager static method)": [[26, "kiwi.volume_manager.VolumeManager.new", false]], "ociconfig (class in kiwi.container.oci)": [[10, "kiwi.container.oci.OciConfig", false]], "ofw_mode() (kiwi.firmware.firmware method)": [[1, "kiwi.firmware.FirmWare.ofw_mode", false]], "omit_module() (kiwi.boot.image.base.bootimagebase method)": [[4, "kiwi.boot.image.base.BootImageBase.omit_module", false]], "omit_module() (kiwi.boot.image.dracut.bootimagedracut method)": [[4, "kiwi.boot.image.dracut.BootImageDracut.omit_module", false]], "opal_mode() (kiwi.firmware.firmware method)": [[1, "kiwi.firmware.FirmWare.opal_mode", false]], "output (kiwi.command.commandcallt attribute)": [[1, "kiwi.command.CommandCallT.output", false]], "output (kiwi.command.commandt attribute)": [[1, "kiwi.command.CommandT.output", false]], "output_available (kiwi.command.commandcallt attribute)": [[1, "kiwi.command.CommandCallT.output_available", false]], "overlay_mount() (kiwi.mount_manager.mountmanager method)": [[1, "kiwi.mount_manager.MountManager.overlay_mount", false]], "owner (kiwi.xml_state.filet attribute)": [[1, "kiwi.xml_state.FileT.owner", false]], "p (kiwi.system.result.result_name_tags attribute)": [[23, "kiwi.system.result.result_name_tags.P", false], [23, "kiwi.system.result.result_name_tags.p", false]], "package (kiwi.runtime_checker.dracut_module_type attribute)": [[1, "kiwi.runtime_checker.dracut_module_type.package", false]], "package_matches_host_architecture() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.package_matches_host_architecture", false]], "package_section (kiwi.xml_state.package_type attribute)": [[1, "kiwi.xml_state.package_type.package_section", false]], "package_type (class in kiwi.xml_state)": [[1, "kiwi.xml_state.package_type", false]], "packagemanager (class in kiwi.package_manager)": [[14, "kiwi.package_manager.PackageManager", false]], "packagemanagerbase (class in kiwi.package_manager.base)": [[14, "kiwi.package_manager.base.PackageManagerBase", false]], "packagemanagerdnf4 (class in kiwi.package_manager.dnf4)": [[14, "kiwi.package_manager.dnf4.PackageManagerDnf4", false]], "packagemanagertemplateaptget (class in kiwi.repository.template.apt)": [[17, "kiwi.repository.template.apt.PackageManagerTemplateAptGet", false]], "packagemanagerzypper (class in kiwi.package_manager.zypper)": [[14, "kiwi.package_manager.zypper.PackageManagerZypper", false]], "packages_section (kiwi.xml_state.package_type attribute)": [[1, "kiwi.xml_state.package_type.packages_section", false]], "parent (kiwi.xml_state.volume_type attribute)": [[1, "kiwi.xml_state.volume_type.parent", false]], "partition_name (kiwi.storage.disk.ptable_entry_type attribute)": [[20, "kiwi.storage.disk.ptable_entry_type.partition_name", false]], "partition_type (kiwi.storage.disk.ptable_entry_type attribute)": [[20, "kiwi.storage.disk.ptable_entry_type.partition_type", false]], "partitioner (class in kiwi.partitioner)": [[15, "kiwi.partitioner.Partitioner", false]], "partitionerbase (class in kiwi.partitioner.base)": [[15, "kiwi.partitioner.base.PartitionerBase", false]], "partitionerdasd (class in kiwi.partitioner.dasd)": [[15, "kiwi.partitioner.dasd.PartitionerDasd", false]], "partitionergpt (class in kiwi.partitioner.gpt)": [[15, "kiwi.partitioner.gpt.PartitionerGpt", false]], "partitionermsdos (class in kiwi.partitioner.msdos)": [[15, "kiwi.partitioner.msdos.PartitionerMsDos", false]], "path (class in kiwi.path)": [[1, "kiwi.path.Path", false]], "permissions (kiwi.xml_state.filet attribute)": [[1, "kiwi.xml_state.FileT.permissions", false]], "pinch_system() (kiwi.system.prepare.systemprepare method)": [[23, "kiwi.system.prepare.SystemPrepare.pinch_system", false]], "poll() (kiwi.command_process.commandprocess method)": [[1, "kiwi.command_process.CommandProcess.poll", false]], "poll_and_watch() (kiwi.command_process.commandprocess method)": [[1, "kiwi.command_process.CommandProcess.poll_and_watch", false]], "poll_show_progress() (kiwi.command_process.commandprocess method)": [[1, "kiwi.command_process.CommandProcess.poll_show_progress", false]], "post_init() (kiwi.boot.image.base.bootimagebase method)": [[4, "kiwi.boot.image.base.BootImageBase.post_init", false]], "post_init() (kiwi.boot.image.builtin_kiwi.bootimagekiwi method)": [[4, "kiwi.boot.image.builtin_kiwi.BootImageKiwi.post_init", false]], "post_init() (kiwi.boot.image.dracut.bootimagedracut method)": [[4, "kiwi.boot.image.dracut.BootImageDracut.post_init", false]], "post_init() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.post_init", false]], "post_init() (kiwi.bootloader.config.grub2.bootloaderconfiggrub2 method)": [[6, "kiwi.bootloader.config.grub2.BootLoaderConfigGrub2.post_init", false]], "post_init() (kiwi.bootloader.install.base.bootloaderinstallbase method)": [[7, "kiwi.bootloader.install.base.BootLoaderInstallBase.post_init", false]], "post_init() (kiwi.bootloader.install.grub2.bootloaderinstallgrub2 method)": [[7, "kiwi.bootloader.install.grub2.BootLoaderInstallGrub2.post_init", false]], "post_init() (kiwi.bootloader.install.systemd_boot.bootloaderinstallsystemdboot method)": [[7, "kiwi.bootloader.install.systemd_boot.BootLoaderInstallSystemdBoot.post_init", false]], "post_init() (kiwi.bootloader.install.zipl.bootloaderinstallzipl method)": [[7, "kiwi.bootloader.install.zipl.BootLoaderInstallZipl.post_init", false]], "post_init() (kiwi.container.setup.base.containersetupbase method)": [[11, "kiwi.container.setup.base.ContainerSetupBase.post_init", false]], "post_init() (kiwi.filesystem.base.filesystembase method)": [[12, "kiwi.filesystem.base.FileSystemBase.post_init", false]], "post_init() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.post_init", false]], "post_init() (kiwi.package_manager.dnf4.packagemanagerdnf4 method)": [[14, "kiwi.package_manager.dnf4.PackageManagerDnf4.post_init", false]], "post_init() (kiwi.package_manager.zypper.packagemanagerzypper method)": [[14, "kiwi.package_manager.zypper.PackageManagerZypper.post_init", false]], "post_init() (kiwi.partitioner.base.partitionerbase method)": [[15, "kiwi.partitioner.base.PartitionerBase.post_init", false]], "post_init() (kiwi.partitioner.dasd.partitionerdasd method)": [[15, "kiwi.partitioner.dasd.PartitionerDasd.post_init", false]], "post_init() (kiwi.partitioner.gpt.partitionergpt method)": [[15, "kiwi.partitioner.gpt.PartitionerGpt.post_init", false]], "post_init() (kiwi.partitioner.msdos.partitionermsdos method)": [[15, "kiwi.partitioner.msdos.PartitionerMsDos.post_init", false]], "post_init() (kiwi.repository.base.repositorybase method)": [[16, "kiwi.repository.base.RepositoryBase.post_init", false]], "post_init() (kiwi.repository.dnf4.repositorydnf4 method)": [[16, "kiwi.repository.dnf4.RepositoryDnf4.post_init", false]], "post_init() (kiwi.repository.zypper.repositoryzypper method)": [[16, "kiwi.repository.zypper.RepositoryZypper.post_init", false]], "post_init() (kiwi.storage.subformat.base.diskformatbase method)": [[21, "kiwi.storage.subformat.base.DiskFormatBase.post_init", false]], "post_init() (kiwi.storage.subformat.gce.diskformatgce method)": [[21, "kiwi.storage.subformat.gce.DiskFormatGce.post_init", false]], "post_init() (kiwi.storage.subformat.ova.diskformatova method)": [[21, "kiwi.storage.subformat.ova.DiskFormatOva.post_init", false]], "post_init() (kiwi.storage.subformat.qcow2.diskformatqcow2 method)": [[21, "kiwi.storage.subformat.qcow2.DiskFormatQcow2.post_init", false]], "post_init() (kiwi.storage.subformat.vagrant_base.diskformatvagrantbase method)": [[21, "kiwi.storage.subformat.vagrant_base.DiskFormatVagrantBase.post_init", false]], "post_init() (kiwi.storage.subformat.vdi.diskformatvdi method)": [[21, "kiwi.storage.subformat.vdi.DiskFormatVdi.post_init", false]], "post_init() (kiwi.storage.subformat.vhd.diskformatvhd method)": [[21, "kiwi.storage.subformat.vhd.DiskFormatVhd.post_init", false]], "post_init() (kiwi.storage.subformat.vhdfixed.diskformatvhdfixed method)": [[21, "kiwi.storage.subformat.vhdfixed.DiskFormatVhdFixed.post_init", false]], "post_init() (kiwi.storage.subformat.vhdx.diskformatvhdx method)": [[21, "kiwi.storage.subformat.vhdx.DiskFormatVhdx.post_init", false]], "post_init() (kiwi.storage.subformat.vmdk.diskformatvmdk method)": [[21, "kiwi.storage.subformat.vmdk.DiskFormatVmdk.post_init", false]], "post_init() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.post_init", false]], "post_init() (kiwi.volume_manager.btrfs.volumemanagerbtrfs method)": [[26, "kiwi.volume_manager.btrfs.VolumeManagerBtrfs.post_init", false]], "post_init() (kiwi.volume_manager.lvm.volumemanagerlvm method)": [[26, "kiwi.volume_manager.lvm.VolumeManagerLVM.post_init", false]], "post_process_delete_requests() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.post_process_delete_requests", false]], "post_process_install_requests_bootstrap() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.post_process_install_requests_bootstrap", false]], "post_process_install_requests_bootstrap() (kiwi.package_manager.dnf4.packagemanagerdnf4 method)": [[14, "kiwi.package_manager.dnf4.PackageManagerDnf4.post_process_install_requests_bootstrap", false]], "post_process_install_requests_bootstrap() (kiwi.package_manager.zypper.packagemanagerzypper method)": [[14, "kiwi.package_manager.zypper.PackageManagerZypper.post_process_install_requests_bootstrap", false]], "preferences_matches_host_architecture() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.preferences_matches_host_architecture", false]], "prepare() (kiwi.boot.image.base.bootimagebase method)": [[4, "kiwi.boot.image.base.BootImageBase.prepare", false]], "prepare() (kiwi.boot.image.builtin_kiwi.bootimagekiwi method)": [[4, "kiwi.boot.image.builtin_kiwi.BootImageKiwi.prepare", false]], "prepare() (kiwi.boot.image.dracut.bootimagedracut method)": [[4, "kiwi.boot.image.dracut.BootImageDracut.prepare", false]], "print_results() (kiwi.system.result.result method)": [[23, "kiwi.system.result.Result.print_results", false]], "print_sensitive() (kiwi.system.uri.uri static method)": [[23, "kiwi.system.uri.Uri.print_sensitive", false]], "privileges (class in kiwi.privileges)": [[1, "kiwi.privileges.Privileges", false]], "process (kiwi.command.commandcallt attribute)": [[1, "kiwi.command.CommandCallT.process", false]], "process() (kiwi.tasks.result_bundle.resultbundletask method)": [[24, "kiwi.tasks.result_bundle.ResultBundleTask.process", false]], "process() (kiwi.tasks.result_list.resultlisttask method)": [[24, "kiwi.tasks.result_list.ResultListTask.process", false]], "process() (kiwi.tasks.system_build.systembuildtask method)": [[24, "kiwi.tasks.system_build.SystemBuildTask.process", false]], "process() (kiwi.tasks.system_create.systemcreatetask method)": [[24, "kiwi.tasks.system_create.SystemCreateTask.process", false]], "process() (kiwi.tasks.system_prepare.systempreparetask method)": [[24, "kiwi.tasks.system_prepare.SystemPrepareTask.process", false]], "process() (kiwi.tasks.system_update.systemupdatetask method)": [[24, "kiwi.tasks.system_update.SystemUpdateTask.process", false]], "process_delete_requests() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.process_delete_requests", false]], "process_delete_requests() (kiwi.package_manager.dnf4.packagemanagerdnf4 method)": [[14, "kiwi.package_manager.dnf4.PackageManagerDnf4.process_delete_requests", false]], "process_delete_requests() (kiwi.package_manager.zypper.packagemanagerzypper method)": [[14, "kiwi.package_manager.zypper.PackageManagerZypper.process_delete_requests", false]], "process_install_requests() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.process_install_requests", false]], "process_install_requests() (kiwi.package_manager.dnf4.packagemanagerdnf4 method)": [[14, "kiwi.package_manager.dnf4.PackageManagerDnf4.process_install_requests", false]], "process_install_requests() (kiwi.package_manager.zypper.packagemanagerzypper method)": [[14, "kiwi.package_manager.zypper.PackageManagerZypper.process_install_requests", false]], "process_install_requests_bootstrap() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.process_install_requests_bootstrap", false]], "process_install_requests_bootstrap() (kiwi.package_manager.dnf4.packagemanagerdnf4 method)": [[14, "kiwi.package_manager.dnf4.PackageManagerDnf4.process_install_requests_bootstrap", false]], "process_install_requests_bootstrap() (kiwi.package_manager.zypper.packagemanagerzypper method)": [[14, "kiwi.package_manager.zypper.PackageManagerZypper.process_install_requests_bootstrap", false]], "process_only_required() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.process_only_required", false]], "process_only_required() (kiwi.package_manager.dnf4.packagemanagerdnf4 method)": [[14, "kiwi.package_manager.dnf4.PackageManagerDnf4.process_only_required", false]], "process_only_required() (kiwi.package_manager.zypper.packagemanagerzypper method)": [[14, "kiwi.package_manager.zypper.PackageManagerZypper.process_only_required", false]], "process_plus_recommended() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.process_plus_recommended", false]], "process_plus_recommended() (kiwi.package_manager.dnf4.packagemanagerdnf4 method)": [[14, "kiwi.package_manager.dnf4.PackageManagerDnf4.process_plus_recommended", false]], "process_plus_recommended() (kiwi.package_manager.zypper.packagemanagerzypper method)": [[14, "kiwi.package_manager.zypper.PackageManagerZypper.process_plus_recommended", false]], "profile (class in kiwi.system.profile)": [[23, "kiwi.system.profile.Profile", false]], "profile_matches_host_architecture() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.profile_matches_host_architecture", false]], "progress() (kiwi.logger.logger static method)": [[1, "kiwi.logger.Logger.progress", false]], "project_file() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.project_file", false]], "protected_map_ids (kiwi.storage.disk.disk attribute)": [[20, "kiwi.storage.disk.Disk.protected_map_ids", false]], "ptable_entry_type (class in kiwi.storage.disk)": [[20, "kiwi.storage.disk.ptable_entry_type", false]], "quadruple_token() (kiwi.tasks.base.clitask method)": [[24, "kiwi.tasks.base.CliTask.quadruple_token", false]], "quote() (kiwi.system.shell.shell static method)": [[23, "kiwi.system.shell.Shell.quote", false]], "quote_key_value_file() (kiwi.system.shell.shell static method)": [[23, "kiwi.system.shell.Shell.quote_key_value_file", false]], "quote_title() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.quote_title", false]], "raid_root (kiwi.builder.disk.storagemap attribute)": [[9, "kiwi.builder.disk.StorageMap.raid_root", false]], "raiddevice (class in kiwi.storage.raid_device)": [[20, "kiwi.storage.raid_device.RaidDevice", false]], "realpath (kiwi.xml_state.volume_type attribute)": [[1, "kiwi.xml_state.volume_type.realpath", false]], "rebase_to_root() (kiwi.path.path static method)": [[1, "kiwi.path.Path.rebase_to_root", false]], "remove_hierarchy() (kiwi.path.path static method)": [[1, "kiwi.path.Path.remove_hierarchy", false]], "repository (class in kiwi.repository)": [[16, "kiwi.repository.Repository", false]], "repository_matches_host_architecture() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.repository_matches_host_architecture", false]], "repositorybase (class in kiwi.repository.base)": [[16, "kiwi.repository.base.RepositoryBase", false]], "repositorydnf4 (class in kiwi.repository.dnf4)": [[16, "kiwi.repository.dnf4.RepositoryDnf4", false]], "repositoryzypper (class in kiwi.repository.zypper)": [[16, "kiwi.repository.zypper.RepositoryZypper", false]], "request_collection() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.request_collection", false]], "request_collection() (kiwi.package_manager.dnf4.packagemanagerdnf4 method)": [[14, "kiwi.package_manager.dnf4.PackageManagerDnf4.request_collection", false]], "request_collection() (kiwi.package_manager.zypper.packagemanagerzypper method)": [[14, "kiwi.package_manager.zypper.PackageManagerZypper.request_collection", false]], "request_package() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.request_package", false]], "request_package() (kiwi.package_manager.dnf4.packagemanagerdnf4 method)": [[14, "kiwi.package_manager.dnf4.PackageManagerDnf4.request_package", false]], "request_package() (kiwi.package_manager.zypper.packagemanagerzypper method)": [[14, "kiwi.package_manager.zypper.PackageManagerZypper.request_package", false]], "request_package_exclusion() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.request_package_exclusion", false]], "request_package_exclusion() (kiwi.package_manager.dnf4.packagemanagerdnf4 method)": [[14, "kiwi.package_manager.dnf4.PackageManagerDnf4.request_package_exclusion", false]], "request_package_exclusion() (kiwi.package_manager.zypper.packagemanagerzypper method)": [[14, "kiwi.package_manager.zypper.PackageManagerZypper.request_package_exclusion", false]], "request_package_lock() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.request_package_lock", false]], "request_product() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.request_product", false]], "request_product() (kiwi.package_manager.dnf4.packagemanagerdnf4 method)": [[14, "kiwi.package_manager.dnf4.PackageManagerDnf4.request_product", false]], "request_product() (kiwi.package_manager.zypper.packagemanagerzypper method)": [[14, "kiwi.package_manager.zypper.PackageManagerZypper.request_product", false]], "resize_raw_disk() (kiwi.storage.subformat.base.diskformatbase method)": [[21, "kiwi.storage.subformat.base.DiskFormatBase.resize_raw_disk", false]], "resize_table() (kiwi.partitioner.base.partitionerbase method)": [[15, "kiwi.partitioner.base.PartitionerBase.resize_table", false]], "resize_table() (kiwi.partitioner.dasd.partitionerdasd method)": [[15, "kiwi.partitioner.dasd.PartitionerDasd.resize_table", false]], "resize_table() (kiwi.partitioner.gpt.partitionergpt method)": [[15, "kiwi.partitioner.gpt.PartitionerGpt.resize_table", false]], "resize_table() (kiwi.partitioner.msdos.partitionermsdos method)": [[15, "kiwi.partitioner.msdos.PartitionerMsDos.resize_table", false]], "resolve_this_path() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.resolve_this_path", false]], "result (class in kiwi.system.result)": [[23, "kiwi.system.result.Result", false]], "result_file_type (class in kiwi.system.result)": [[23, "kiwi.system.result.result_file_type", false]], "result_name_tags (class in kiwi.system.result)": [[23, "kiwi.system.result.result_name_tags", false]], "resultbundletask (class in kiwi.tasks.result_bundle)": [[24, "kiwi.tasks.result_bundle.ResultBundleTask", false]], "resultlisttask (class in kiwi.tasks.result_list)": [[24, "kiwi.tasks.result_list.ResultListTask", false]], "returncode (kiwi.command.commandt attribute)": [[1, "kiwi.command.CommandT.returncode", false]], "returncode() (kiwi.command_process.commandprocess method)": [[1, "kiwi.command_process.CommandProcess.returncode", false]], "root_dir (kiwi.volume_manager.base.volumemanagerbase attribute)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.root_dir", false]], "rootbind (class in kiwi.system.root_bind)": [[23, "kiwi.system.root_bind.RootBind", false]], "rootinit (class in kiwi.system.root_init)": [[23, "kiwi.system.root_init.RootInit", false]], "run() (kiwi.command.command static method)": [[1, "kiwi.command.Command.run", false]], "run_checks() (kiwi.tasks.base.clitask method)": [[24, "kiwi.tasks.base.CliTask.run_checks", false]], "run_common_function() (kiwi.system.shell.shell static method)": [[23, "kiwi.system.shell.Shell.run_common_function", false]], "run_repo_customize() (kiwi.repository.base.repositorybase static method)": [[16, "kiwi.repository.base.RepositoryBase.run_repo_customize", false]], "runtime_config() (kiwi.repository.base.repositorybase method)": [[16, "kiwi.repository.base.RepositoryBase.runtime_config", false]], "runtime_config() (kiwi.repository.dnf4.repositorydnf4 method)": [[16, "kiwi.repository.dnf4.RepositoryDnf4.runtime_config", false]], "runtime_config() (kiwi.repository.zypper.repositoryzypper method)": [[16, "kiwi.repository.zypper.RepositoryZypper.runtime_config", false]], "runtimechecker (class in kiwi.runtime_checker)": [[1, "kiwi.runtime_checker.RuntimeChecker", false]], "runtimeconfig (class in kiwi.runtime_config)": [[1, "kiwi.runtime_config.RuntimeConfig", false]], "sat (class in kiwi.solver.sat)": [[18, "kiwi.solver.sat.Sat", false]], "script_exists() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.script_exists", false]], "secure_boot_install() (kiwi.bootloader.install.base.bootloaderinstallbase method)": [[7, "kiwi.bootloader.install.base.BootLoaderInstallBase.secure_boot_install", false]], "secure_boot_install() (kiwi.bootloader.install.grub2.bootloaderinstallgrub2 method)": [[7, "kiwi.bootloader.install.grub2.BootLoaderInstallGrub2.secure_boot_install", false]], "secure_boot_install() (kiwi.bootloader.install.systemd_boot.bootloaderinstallsystemdboot method)": [[7, "kiwi.bootloader.install.systemd_boot.BootLoaderInstallSystemdBoot.secure_boot_install", false]], "secure_boot_install() (kiwi.bootloader.install.zipl.bootloaderinstallzipl method)": [[7, "kiwi.bootloader.install.zipl.BootLoaderInstallZipl.secure_boot_install", false]], "set_color_format() (kiwi.logger.logger method)": [[1, "kiwi.logger.Logger.set_color_format", false]], "set_container_config_tag() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.set_container_config_tag", false]], "set_custom_runtime_config_file() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.set_custom_runtime_config_file", false]], "set_derived_from_image_uri() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.set_derived_from_image_uri", false]], "set_disk_password() (kiwi.bootloader.install.grub2.bootloaderinstallgrub2 method)": [[7, "kiwi.bootloader.install.grub2.BootLoaderInstallGrub2.set_disk_password", false]], "set_dist_type() (kiwi.solver.sat.sat method)": [[18, "kiwi.solver.sat.Sat.set_dist_type", false]], "set_flag() (kiwi.partitioner.base.partitionerbase method)": [[15, "kiwi.partitioner.base.PartitionerBase.set_flag", false]], "set_flag() (kiwi.partitioner.gpt.partitionergpt method)": [[15, "kiwi.partitioner.gpt.PartitionerGpt.set_flag", false]], "set_flag() (kiwi.partitioner.msdos.partitionermsdos method)": [[15, "kiwi.partitioner.msdos.PartitionerMsDos.set_flag", false]], "set_hybrid_mbr() (kiwi.partitioner.base.partitionerbase method)": [[15, "kiwi.partitioner.base.PartitionerBase.set_hybrid_mbr", false]], "set_hybrid_mbr() (kiwi.partitioner.gpt.partitionergpt method)": [[15, "kiwi.partitioner.gpt.PartitionerGpt.set_hybrid_mbr", false]], "set_loader_entry() (kiwi.bootloader.config.systemd_boot.bootloadersystemdboot method)": [[6, "kiwi.bootloader.config.systemd_boot.BootLoaderSystemdBoot.set_loader_entry", false]], "set_loader_entry() (kiwi.bootloader.config.zipl.bootloaderzipl method)": [[6, "kiwi.bootloader.config.zipl.BootLoaderZipl.set_loader_entry", false]], "set_log_socket() (kiwi.logger.logger method)": [[1, "kiwi.logger.Logger.set_log_socket", false]], "set_logfile() (kiwi.logger.logger method)": [[1, "kiwi.logger.Logger.set_logfile", false]], "set_mbr() (kiwi.partitioner.base.partitionerbase method)": [[15, "kiwi.partitioner.base.PartitionerBase.set_mbr", false]], "set_mbr() (kiwi.partitioner.gpt.partitionergpt method)": [[15, "kiwi.partitioner.gpt.PartitionerGpt.set_mbr", false]], "set_media_tag() (kiwi.iso_tools.iso.iso static method)": [[13, "kiwi.iso_tools.iso.Iso.set_media_tag", false]], "set_platform_name() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.set_platform_name", false]], "set_property_readonly_root() (kiwi.filesystem.base.filesystembase method)": [[12, "kiwi.filesystem.base.FileSystemBase.set_property_readonly_root", false]], "set_property_readonly_root() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.set_property_readonly_root", false]], "set_property_readonly_root() (kiwi.volume_manager.btrfs.volumemanagerbtrfs method)": [[26, "kiwi.volume_manager.btrfs.VolumeManagerBtrfs.set_property_readonly_root", false]], "set_repository() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.set_repository", false]], "set_root_filesystem_uuid() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.set_root_filesystem_uuid", false]], "set_root_partition_uuid() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.set_root_partition_uuid", false]], "set_runtime_checker_metadata() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.set_runtime_checker_metadata", false]], "set_selinux_file_contexts() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.set_selinux_file_contexts", false]], "set_shared_cache_location() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.set_shared_cache_location", false]], "set_start_sector() (kiwi.partitioner.base.partitionerbase method)": [[15, "kiwi.partitioner.base.PartitionerBase.set_start_sector", false]], "set_start_sector() (kiwi.partitioner.msdos.partitionermsdos method)": [[15, "kiwi.partitioner.msdos.PartitionerMsDos.set_start_sector", false]], "set_start_sector() (kiwi.storage.disk.disk method)": [[20, "kiwi.storage.disk.Disk.set_start_sector", false]], "set_static_modules() (kiwi.boot.image.base.bootimagebase method)": [[4, "kiwi.boot.image.base.BootImageBase.set_static_modules", false]], "set_static_modules() (kiwi.boot.image.dracut.bootimagedracut method)": [[4, "kiwi.boot.image.dracut.BootImageDracut.set_static_modules", false]], "set_temp_location() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.set_temp_location", false]], "set_uuid() (kiwi.filesystem.base.filesystembase method)": [[12, "kiwi.filesystem.base.FileSystemBase.set_uuid", false]], "set_uuid() (kiwi.filesystem.btrfs.filesystembtrfs method)": [[12, "kiwi.filesystem.btrfs.FileSystemBtrfs.set_uuid", false]], "set_uuid() (kiwi.filesystem.ext2.filesystemext2 method)": [[12, "kiwi.filesystem.ext2.FileSystemExt2.set_uuid", false]], "set_uuid() (kiwi.filesystem.ext3.filesystemext3 method)": [[12, "kiwi.filesystem.ext3.FileSystemExt3.set_uuid", false]], "set_uuid() (kiwi.filesystem.ext4.filesystemext4 method)": [[12, "kiwi.filesystem.ext4.FileSystemExt4.set_uuid", false]], "set_uuid() (kiwi.filesystem.fat16.filesystemfat16 method)": [[12, "kiwi.filesystem.fat16.FileSystemFat16.set_uuid", false]], "set_uuid() (kiwi.filesystem.fat32.filesystemfat32 method)": [[12, "kiwi.filesystem.fat32.FileSystemFat32.set_uuid", false]], "set_uuid() (kiwi.filesystem.xfs.filesystemxfs method)": [[12, "kiwi.filesystem.xfs.FileSystemXfs.set_uuid", false]], "set_uuid() (kiwi.partitioner.base.partitionerbase method)": [[15, "kiwi.partitioner.base.PartitionerBase.set_uuid", false]], "set_uuid() (kiwi.partitioner.dasd.partitionerdasd method)": [[15, "kiwi.partitioner.dasd.PartitionerDasd.set_uuid", false]], "set_uuid() (kiwi.partitioner.gpt.partitionergpt method)": [[15, "kiwi.partitioner.gpt.PartitionerGpt.set_uuid", false]], "set_uuid() (kiwi.partitioner.msdos.partitionermsdos method)": [[15, "kiwi.partitioner.msdos.PartitionerMsDos.set_uuid", false]], "setlogflag() (kiwi.logger.logger method)": [[1, "kiwi.logger.Logger.setLogFlag", false]], "setloglevel() (kiwi.logger.logger method)": [[1, "kiwi.logger.Logger.setLogLevel", false]], "setup() (kiwi.container.setup.base.containersetupbase method)": [[11, "kiwi.container.setup.base.ContainerSetupBase.setup", false]], "setup() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.setup", false]], "setup() (kiwi.volume_manager.btrfs.volumemanagerbtrfs method)": [[26, "kiwi.volume_manager.btrfs.VolumeManagerBtrfs.setup", false]], "setup() (kiwi.volume_manager.lvm.volumemanagerlvm method)": [[26, "kiwi.volume_manager.lvm.VolumeManagerLVM.setup", false]], "setup_disk_boot_images() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.setup_disk_boot_images", false]], "setup_disk_boot_images() (kiwi.bootloader.config.grub2.bootloaderconfiggrub2 method)": [[6, "kiwi.bootloader.config.grub2.BootLoaderConfigGrub2.setup_disk_boot_images", false]], "setup_disk_image_config() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.setup_disk_image_config", false]], "setup_disk_image_config() (kiwi.bootloader.config.grub2.bootloaderconfiggrub2 method)": [[6, "kiwi.bootloader.config.grub2.BootLoaderConfigGrub2.setup_disk_image_config", false]], "setup_groups() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.setup_groups", false]], "setup_home_for_user() (kiwi.system.users.users method)": [[23, "kiwi.system.users.Users.setup_home_for_user", false]], "setup_install_boot_images() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.setup_install_boot_images", false]], "setup_install_boot_images() (kiwi.bootloader.config.grub2.bootloaderconfiggrub2 method)": [[6, "kiwi.bootloader.config.grub2.BootLoaderConfigGrub2.setup_install_boot_images", false]], "setup_install_image_config() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.setup_install_image_config", false]], "setup_install_image_config() (kiwi.bootloader.config.grub2.bootloaderconfiggrub2 method)": [[6, "kiwi.bootloader.config.grub2.BootLoaderConfigGrub2.setup_install_image_config", false]], "setup_intermediate_config() (kiwi.system.root_bind.rootbind method)": [[23, "kiwi.system.root_bind.RootBind.setup_intermediate_config", false]], "setup_keyboard_map() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.setup_keyboard_map", false]], "setup_live_boot_images() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.setup_live_boot_images", false]], "setup_live_boot_images() (kiwi.bootloader.config.grub2.bootloaderconfiggrub2 method)": [[6, "kiwi.bootloader.config.grub2.BootLoaderConfigGrub2.setup_live_boot_images", false]], "setup_live_image_config() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.setup_live_image_config", false]], "setup_live_image_config() (kiwi.bootloader.config.grub2.bootloaderconfiggrub2 method)": [[6, "kiwi.bootloader.config.grub2.BootLoaderConfigGrub2.setup_live_image_config", false]], "setup_loader() (kiwi.bootloader.config.systemd_boot.bootloadersystemdboot method)": [[6, "kiwi.bootloader.config.systemd_boot.BootLoaderSystemdBoot.setup_loader", false]], "setup_loader() (kiwi.bootloader.config.zipl.bootloaderzipl method)": [[6, "kiwi.bootloader.config.zipl.BootLoaderZipl.setup_loader", false]], "setup_locale() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.setup_locale", false]], "setup_machine_id() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.setup_machine_id", false]], "setup_media_loader_directory() (kiwi.iso_tools.base.isotoolsbase static method)": [[13, "kiwi.iso_tools.base.IsoToolsBase.setup_media_loader_directory", false]], "setup_mountpoint() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.setup_mountpoint", false]], "setup_package_database_configuration() (kiwi.repository.base.repositorybase method)": [[16, "kiwi.repository.base.RepositoryBase.setup_package_database_configuration", false]], "setup_package_database_configuration() (kiwi.repository.dnf4.repositorydnf4 method)": [[16, "kiwi.repository.dnf4.RepositoryDnf4.setup_package_database_configuration", false]], "setup_package_database_configuration() (kiwi.repository.zypper.repositoryzypper method)": [[16, "kiwi.repository.zypper.RepositoryZypper.setup_package_database_configuration", false]], "setup_permissions() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.setup_permissions", false]], "setup_plymouth_splash() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.setup_plymouth_splash", false]], "setup_registry_import() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.setup_registry_import", false]], "setup_repositories() (kiwi.system.prepare.systemprepare method)": [[23, "kiwi.system.prepare.SystemPrepare.setup_repositories", false]], "setup_repository_modules() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.setup_repository_modules", false]], "setup_repository_modules() (kiwi.package_manager.dnf4.packagemanagerdnf4 method)": [[14, "kiwi.package_manager.dnf4.PackageManagerDnf4.setup_repository_modules", false]], "setup_repository_modules() (kiwi.package_manager.zypper.packagemanagerzypper method)": [[14, "kiwi.package_manager.zypper.PackageManagerZypper.setup_repository_modules", false]], "setup_root_console() (kiwi.container.setup.base.containersetupbase method)": [[11, "kiwi.container.setup.base.ContainerSetupBase.setup_root_console", false]], "setup_selinux_file_contexts() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.setup_selinux_file_contexts", false]], "setup_sysconfig_bootloader() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.setup_sysconfig_bootloader", false]], "setup_sysconfig_bootloader() (kiwi.bootloader.config.grub2.bootloaderconfiggrub2 method)": [[6, "kiwi.bootloader.config.grub2.BootLoaderConfigGrub2.setup_sysconfig_bootloader", false]], "setup_timezone() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.setup_timezone", false]], "setup_users() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.setup_users", false]], "sha256() (kiwi.utils.checksum.checksum method)": [[25, "kiwi.utils.checksum.Checksum.sha256", false]], "shasum (kiwi.system.result.result_file_type attribute)": [[23, "kiwi.system.result.result_file_type.shasum", false]], "shell (class in kiwi.system.shell)": [[23, "kiwi.system.shell.Shell", false]], "shim_loader_type (class in kiwi.defaults)": [[1, "kiwi.defaults.shim_loader_type", false]], "show() (kiwi.help.help method)": [[1, "kiwi.help.Help.show", false]], "show_and_exit_on_help_request() (kiwi.cli.cli method)": [[1, "kiwi.cli.Cli.show_and_exit_on_help_request", false]], "size (kiwi.xml_state.volume_type attribute)": [[1, "kiwi.xml_state.volume_type.size", false]], "size_type (class in kiwi.xml_state)": [[1, "kiwi.xml_state.size_type", false]], "solve() (kiwi.solver.sat.sat method)": [[18, "kiwi.solver.sat.Sat.solve", false]], "solverrepository (class in kiwi.solver.repository)": [[19, "kiwi.solver.repository.SolverRepository", false]], "solverrepositorybase (class in kiwi.solver.repository.base)": [[19, "kiwi.solver.repository.base.SolverRepositoryBase", false]], "solverrepositoryrpmdir (class in kiwi.solver.repository.rpm_dir)": [[19, "kiwi.solver.repository.rpm_dir.SolverRepositoryRpmDir", false]], "solverrepositoryrpmmd (class in kiwi.solver.repository.rpm_md)": [[19, "kiwi.solver.repository.rpm_md.SolverRepositoryRpmMd", false]], "solverrepositorysuse (class in kiwi.solver.repository.suse)": [[19, "kiwi.solver.repository.suse.SolverRepositorySUSE", false]], "sort_by_hierarchy() (kiwi.path.path static method)": [[1, "kiwi.path.Path.sort_by_hierarchy", false]], "specification (kiwi.xml_state.description_type attribute)": [[1, "kiwi.xml_state.description_type.specification", false]], "storage_provider (kiwi.storage.disk.disk attribute)": [[20, "kiwi.storage.disk.Disk.storage_provider", false]], "storage_provider (kiwi.storage.luks_device.luksdevice attribute)": [[20, "kiwi.storage.luks_device.LuksDevice.storage_provider", false]], "storage_provider (kiwi.storage.raid_device.raiddevice attribute)": [[20, "kiwi.storage.raid_device.RaidDevice.storage_provider", false]], "storagemap (class in kiwi.builder.disk)": [[9, "kiwi.builder.disk.StorageMap", false]], "store_to_result() (kiwi.storage.subformat.base.diskformatbase method)": [[21, "kiwi.storage.subformat.base.DiskFormatBase.store_to_result", false]], "store_to_result() (kiwi.storage.subformat.gce.diskformatgce method)": [[21, "kiwi.storage.subformat.gce.DiskFormatGce.store_to_result", false]], "store_to_result() (kiwi.storage.subformat.ova.diskformatova method)": [[21, "kiwi.storage.subformat.ova.DiskFormatOva.store_to_result", false]], "store_to_result() (kiwi.storage.subformat.qcow2.diskformatqcow2 method)": [[21, "kiwi.storage.subformat.qcow2.DiskFormatQcow2.store_to_result", false]], "store_to_result() (kiwi.storage.subformat.vagrant_base.diskformatvagrantbase method)": [[21, "kiwi.storage.subformat.vagrant_base.DiskFormatVagrantBase.store_to_result", false]], "store_to_result() (kiwi.storage.subformat.vhdfixed.diskformatvhdfixed method)": [[21, "kiwi.storage.subformat.vhdfixed.DiskFormatVhdFixed.store_to_result", false]], "store_to_result() (kiwi.storage.subformat.vmdk.diskformatvmdk method)": [[21, "kiwi.storage.subformat.vmdk.DiskFormatVmdk.store_to_result", false]], "sync_data() (kiwi.filesystem.base.filesystembase method)": [[12, "kiwi.filesystem.base.FileSystemBase.sync_data", false]], "sync_data() (kiwi.utils.sync.datasync method)": [[25, "kiwi.utils.sync.DataSync.sync_data", false]], "sync_data() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.sync_data", false]], "sync_data() (kiwi.volume_manager.btrfs.volumemanagerbtrfs method)": [[26, "kiwi.volume_manager.btrfs.VolumeManagerBtrfs.sync_data", false]], "sysconfig (class in kiwi.utils.sysconfig)": [[25, "kiwi.utils.sysconfig.SysConfig", false]], "system (kiwi.builder.disk.storagemap attribute)": [[9, "kiwi.builder.disk.StorageMap.system", false]], "system_boot (kiwi.builder.disk.storagemap attribute)": [[9, "kiwi.builder.disk.StorageMap.system_boot", false]], "system_custom_parts (kiwi.builder.disk.storagemap attribute)": [[9, "kiwi.builder.disk.StorageMap.system_custom_parts", false]], "system_efi (kiwi.builder.disk.storagemap attribute)": [[9, "kiwi.builder.disk.StorageMap.system_efi", false]], "system_spare (kiwi.builder.disk.storagemap attribute)": [[9, "kiwi.builder.disk.StorageMap.system_spare", false]], "systembuildtask (class in kiwi.tasks.system_build)": [[24, "kiwi.tasks.system_build.SystemBuildTask", false]], "systemcreatetask (class in kiwi.tasks.system_create)": [[24, "kiwi.tasks.system_create.SystemCreateTask", false]], "systemidentifier (class in kiwi.system.identifier)": [[23, "kiwi.system.identifier.SystemIdentifier", false]], "systemprepare (class in kiwi.system.prepare)": [[23, "kiwi.system.prepare.SystemPrepare", false]], "systempreparetask (class in kiwi.tasks.system_prepare)": [[24, "kiwi.tasks.system_prepare.SystemPrepareTask", false]], "systemsetup (class in kiwi.system.setup)": [[23, "kiwi.system.setup.SystemSetup", false]], "systemsize (class in kiwi.system.size)": [[23, "kiwi.system.size.SystemSize", false]], "systemupdatetask (class in kiwi.tasks.system_update)": [[24, "kiwi.tasks.system_update.SystemUpdateTask", false]], "t (kiwi.system.result.result_name_tags attribute)": [[23, "kiwi.system.result.result_name_tags.T", false]], "target (kiwi.xml_state.filet attribute)": [[1, "kiwi.xml_state.FileT.target", false]], "target_supports_extended_attributes() (kiwi.utils.sync.datasync method)": [[25, "kiwi.utils.sync.DataSync.target_supports_extended_attributes", false]], "tentuple_token() (kiwi.tasks.base.clitask method)": [[24, "kiwi.tasks.base.CliTask.tentuple_token", false]], "timestamp() (kiwi.solver.repository.base.solverrepositorybase method)": [[19, "kiwi.solver.repository.base.SolverRepositoryBase.timestamp", false]], "timestamp() (kiwi.solver.repository.rpm_md.solverrepositoryrpmmd method)": [[19, "kiwi.solver.repository.rpm_md.SolverRepositoryRpmMd.timestamp", false]], "tmpfs_mount() (kiwi.mount_manager.mountmanager method)": [[1, "kiwi.mount_manager.MountManager.tmpfs_mount", false]], "to_profile() (kiwi.defaults.defaults method)": [[1, "kiwi.defaults.Defaults.to_profile", false]], "translate() (kiwi.system.uri.uri method)": [[23, "kiwi.system.uri.Uri.translate", false]], "umount() (kiwi.filesystem.base.filesystembase method)": [[12, "kiwi.filesystem.base.FileSystemBase.umount", false]], "umount() (kiwi.mount_manager.mountmanager method)": [[1, "kiwi.mount_manager.MountManager.umount", false]], "umount() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.umount", false]], "umount_kernel_file_systems() (kiwi.system.root_bind.rootbind method)": [[23, "kiwi.system.root_bind.RootBind.umount_kernel_file_systems", false]], "umount_lazy() (kiwi.mount_manager.mountmanager method)": [[1, "kiwi.mount_manager.MountManager.umount_lazy", false]], "umount_volumes() (kiwi.filesystem.base.filesystembase method)": [[12, "kiwi.filesystem.base.FileSystemBase.umount_volumes", false]], "umount_volumes() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.umount_volumes", false]], "umount_volumes() (kiwi.volume_manager.btrfs.volumemanagerbtrfs method)": [[26, "kiwi.volume_manager.btrfs.VolumeManagerBtrfs.umount_volumes", false]], "umount_volumes() (kiwi.volume_manager.lvm.volumemanagerlvm method)": [[26, "kiwi.volume_manager.lvm.VolumeManagerLVM.umount_volumes", false]], "uncompress() (kiwi.utils.compress.compress method)": [[25, "kiwi.utils.compress.Compress.uncompress", false]], "unit_type (class in kiwi.defaults)": [[1, "kiwi.defaults.unit_type", false]], "update() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.update", false]], "update() (kiwi.package_manager.dnf4.packagemanagerdnf4 method)": [[14, "kiwi.package_manager.dnf4.PackageManagerDnf4.update", false]], "update() (kiwi.package_manager.zypper.packagemanagerzypper method)": [[14, "kiwi.package_manager.zypper.PackageManagerZypper.update", false]], "update_system() (kiwi.system.prepare.systemprepare method)": [[23, "kiwi.system.prepare.SystemPrepare.update_system", false]], "uri (class in kiwi.system.uri)": [[23, "kiwi.system.uri.Uri", false]], "uri_list (kiwi.system.prepare.systemprepare attribute)": [[23, "kiwi.system.prepare.SystemPrepare.uri_list", false]], "usage() (in module kiwi.kiwi)": [[1, "kiwi.kiwi.usage", false]], "use_default_location() (kiwi.repository.base.repositorybase method)": [[16, "kiwi.repository.base.RepositoryBase.use_default_location", false]], "use_default_location() (kiwi.repository.dnf4.repositorydnf4 method)": [[16, "kiwi.repository.dnf4.RepositoryDnf4.use_default_location", false]], "use_default_location() (kiwi.repository.zypper.repositoryzypper method)": [[16, "kiwi.repository.zypper.RepositoryZypper.use_default_location", false]], "use_for_bundle (kiwi.system.result.result_file_type attribute)": [[23, "kiwi.system.result.result_file_type.use_for_bundle", false]], "user (kiwi.container.oci.ociconfig attribute)": [[10, "kiwi.container.oci.OciConfig.user", false]], "user_add() (kiwi.system.users.users method)": [[23, "kiwi.system.users.Users.user_add", false]], "user_exists() (kiwi.system.users.users method)": [[23, "kiwi.system.users.Users.user_exists", false]], "user_modify() (kiwi.system.users.users method)": [[23, "kiwi.system.users.Users.user_modify", false]], "users (class in kiwi.system.users)": [[23, "kiwi.system.users.Users", false]], "v (kiwi.system.result.result_name_tags attribute)": [[23, "kiwi.system.result.result_name_tags.v", false]], "vagrant_post_init() (kiwi.storage.subformat.vagrant_base.diskformatvagrantbase method)": [[21, "kiwi.storage.subformat.vagrant_base.DiskFormatVagrantBase.vagrant_post_init", false]], "vagrant_post_init() (kiwi.storage.subformat.vagrant_libvirt.diskformatvagrantlibvirt method)": [[21, "kiwi.storage.subformat.vagrant_libvirt.DiskFormatVagrantLibVirt.vagrant_post_init", false]], "vagrant_post_init() (kiwi.storage.subformat.vagrant_virtualbox.diskformatvagrantvirtualbox method)": [[21, "kiwi.storage.subformat.vagrant_virtualbox.DiskFormatVagrantVirtualBox.vagrant_post_init", false]], "vagrantconfigtemplate (class in kiwi.storage.subformat.template.vagrant_config)": [[22, "kiwi.storage.subformat.template.vagrant_config.VagrantConfigTemplate", false]], "verify_image_size() (kiwi.system.result.result static method)": [[23, "kiwi.system.result.Result.verify_image_size", false]], "version (kiwi.system.kernel.kernel_type attribute)": [[23, "kiwi.system.kernel.kernel_type.version", false]], "virtualboxovftemplate (class in kiwi.storage.subformat.template.virtualbox_ovf)": [[22, "kiwi.storage.subformat.template.virtualbox_ovf.VirtualboxOvfTemplate", false]], "vmwaresettingstemplate (class in kiwi.storage.subformat.template.vmware_settings)": [[22, "kiwi.storage.subformat.template.vmware_settings.VmwareSettingsTemplate", false]], "volume_group (kiwi.volume_manager.base.volumemanagerbase attribute)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.volume_group", false]], "volume_map (kiwi.volume_manager.base.volumemanagerbase attribute)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.volume_map", false]], "volume_matches_host_architecture() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.volume_matches_host_architecture", false]], "volume_type (class in kiwi.xml_state)": [[1, "kiwi.xml_state.volume_type", false]], "volumemanager (class in kiwi.volume_manager)": [[26, "kiwi.volume_manager.VolumeManager", false]], "volumemanagerbase (class in kiwi.volume_manager.base)": [[26, "kiwi.volume_manager.base.VolumeManagerBase", false]], "volumemanagerbtrfs (class in kiwi.volume_manager.btrfs)": [[26, "kiwi.volume_manager.btrfs.VolumeManagerBtrfs", false]], "volumemanagerlvm (class in kiwi.volume_manager.lvm)": [[26, "kiwi.volume_manager.lvm.VolumeManagerLVM", false]], "volumes (kiwi.container.oci.ociconfig attribute)": [[10, "kiwi.container.oci.OciConfig.volumes", false]], "volumes (kiwi.volume_manager.base.volumemanagerbase attribute)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.volumes", false]], "warningfilter (class in kiwi.logger_filter)": [[1, "kiwi.logger_filter.WarningFilter", false]], "which() (kiwi.path.path static method)": [[1, "kiwi.path.Path.which", false]], "wipe() (kiwi.path.path static method)": [[1, "kiwi.path.Path.wipe", false]], "wipe() (kiwi.storage.disk.disk method)": [[20, "kiwi.storage.disk.Disk.wipe", false]], "workingdir (kiwi.container.oci.ociconfig attribute)": [[10, "kiwi.container.oci.OciConfig.workingdir", false]], "write() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.write", false]], "write() (kiwi.bootloader.config.grub2.bootloaderconfiggrub2 method)": [[6, "kiwi.bootloader.config.grub2.BootLoaderConfigGrub2.write", false]], "write() (kiwi.system.identifier.systemidentifier method)": [[23, "kiwi.system.identifier.SystemIdentifier.write", false]], "write() (kiwi.utils.sysconfig.sysconfig method)": [[25, "kiwi.utils.sysconfig.SysConfig.write", false]], "write_meta_data() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.write_meta_data", false]], "write_meta_data() (kiwi.bootloader.config.grub2.bootloaderconfiggrub2 method)": [[6, "kiwi.bootloader.config.grub2.BootLoaderConfigGrub2.write_meta_data", false]], "write_system_config_file() (kiwi.boot.image.base.bootimagebase method)": [[4, "kiwi.boot.image.base.BootImageBase.write_system_config_file", false]], "write_system_config_file() (kiwi.boot.image.dracut.bootimagedracut method)": [[4, "kiwi.boot.image.dracut.BootImageDracut.write_system_config_file", false]], "write_to_disk() (kiwi.system.identifier.systemidentifier method)": [[23, "kiwi.system.identifier.SystemIdentifier.write_to_disk", false]], "xen_hypervisor_type (class in kiwi.system.kernel)": [[23, "kiwi.system.kernel.xen_hypervisor_type", false]], "xmldescription (class in kiwi.xml_description)": [[1, "kiwi.xml_description.XMLDescription", false]], "xmlstate (class in kiwi.xml_state)": [[1, "kiwi.xml_state.XMLState", false]], "xz() (kiwi.utils.compress.compress method)": [[25, "kiwi.utils.compress.Compress.xz", false]]}, "objects": {"": [[1, 0, 0, "-", "kiwi"]], "kiwi": [[1, 0, 0, "-", "app"], [2, 0, 0, "-", "archive"], [3, 0, 0, "-", "boot"], [5, 0, 0, "-", "bootloader"], [9, 0, 0, "-", "builder"], [1, 0, 0, "-", "cli"], [1, 0, 0, "-", "command"], [1, 0, 0, "-", "command_process"], [10, 0, 0, "-", "container"], [1, 0, 0, "-", "defaults"], [1, 0, 0, "-", "exceptions"], [12, 0, 0, "-", "filesystem"], [1, 0, 0, "-", "firmware"], [1, 0, 0, "-", "help"], [13, 0, 0, "-", "iso_tools"], [1, 0, 0, "-", "kiwi"], [1, 0, 0, "-", "logger"], [1, 0, 0, "-", "logger_color_formatter"], [1, 0, 0, "-", "logger_filter"], [1, 0, 0, "-", "mount_manager"], [14, 0, 0, "-", "package_manager"], [15, 0, 0, "-", "partitioner"], [1, 0, 0, "-", "path"], [1, 0, 0, "-", "privileges"], [16, 0, 0, "-", "repository"], [1, 0, 0, "-", "runtime_checker"], [1, 0, 0, "-", "runtime_config"], [18, 0, 0, "-", "solver"], [20, 0, 0, "-", "storage"], [23, 0, 0, "-", "system"], [24, 0, 0, "-", "tasks"], [25, 0, 0, "-", "utils"], [1, 0, 0, "-", "version"], [26, 0, 0, "-", "volume_manager"], [1, 0, 0, "-", "xml_description"], [1, 0, 0, "-", "xml_state"]], "kiwi.app": [[1, 1, 1, "", "App"]], "kiwi.archive": [[2, 0, 0, "-", "cpio"], [2, 0, 0, "-", "tar"]], "kiwi.archive.cpio": [[2, 1, 1, "", "ArchiveCpio"]], "kiwi.archive.cpio.ArchiveCpio": [[2, 2, 1, "", "create"], [2, 2, 1, "", "extract"]], "kiwi.archive.tar": [[2, 1, 1, "", "ArchiveTar"]], "kiwi.archive.tar.ArchiveTar": [[2, 2, 1, "", "append_files"], [2, 2, 1, "", "create"], [2, 2, 1, "", "create_gnu_gzip_compressed"], [2, 2, 1, "", "create_xz_compressed"], [2, 2, 1, "", "extract"]], "kiwi.boot": [[4, 0, 0, "-", "image"]], "kiwi.boot.image": [[4, 1, 1, "", "BootImage"], [4, 0, 0, "-", "base"], [4, 0, 0, "-", "builtin_kiwi"], [4, 0, 0, "-", "dracut"]], "kiwi.boot.image.BootImage": [[4, 2, 1, "", "new"]], "kiwi.boot.image.base": [[4, 1, 1, "", "BootImageBase"], [4, 1, 1, "", "boot_names_type"]], "kiwi.boot.image.base.BootImageBase": [[4, 2, 1, "", "cleanup"], [4, 2, 1, "", "create_initrd"], [4, 2, 1, "", "get_boot_description_directory"], [4, 2, 1, "", "get_boot_names"], [4, 2, 1, "", "has_initrd_support"], [4, 2, 1, "", "import_system_description_elements"], [4, 2, 1, "", "include_file"], [4, 2, 1, "", "include_module"], [4, 2, 1, "", "is_prepared"], [4, 2, 1, "", "load_boot_xml_description"], [4, 2, 1, "", "omit_module"], [4, 2, 1, "", "post_init"], [4, 2, 1, "", "prepare"], [4, 2, 1, "", "set_static_modules"], [4, 2, 1, "", "write_system_config_file"]], "kiwi.boot.image.base.boot_names_type": [[4, 3, 1, "", "initrd_name"], [4, 3, 1, "", "kernel_filename"], [4, 3, 1, "", "kernel_name"], [4, 3, 1, "", "kernel_version"]], "kiwi.boot.image.builtin_kiwi": [[4, 1, 1, "", "BootImageKiwi"]], "kiwi.boot.image.builtin_kiwi.BootImageKiwi": [[4, 2, 1, "", "cleanup"], [4, 2, 1, "", "create_initrd"], [4, 2, 1, "", "has_initrd_support"], [4, 2, 1, "", "post_init"], [4, 2, 1, "", "prepare"]], "kiwi.boot.image.dracut": [[4, 1, 1, "", "BootImageDracut"]], "kiwi.boot.image.dracut.BootImageDracut": [[4, 2, 1, "", "create_initrd"], [4, 2, 1, "", "has_initrd_support"], [4, 2, 1, "", "include_file"], [4, 2, 1, "", "include_module"], [4, 2, 1, "", "omit_module"], [4, 2, 1, "", "post_init"], [4, 2, 1, "", "prepare"], [4, 2, 1, "", "set_static_modules"], [4, 2, 1, "", "write_system_config_file"]], "kiwi.bootloader": [[6, 0, 0, "-", "config"], [7, 0, 0, "-", "install"], [8, 0, 0, "-", "template"]], "kiwi.bootloader.config": [[6, 0, 0, "-", "base"], [6, 4, 1, "", "create_boot_loader_config"], [6, 0, 0, "-", "grub2"], [6, 0, 0, "-", "systemd_boot"], [6, 0, 0, "-", "zipl"]], "kiwi.bootloader.config.base": [[6, 1, 1, "", "BootLoaderConfigBase"]], "kiwi.bootloader.config.base.BootLoaderConfigBase": [[6, 2, 1, "", "create_efi_path"], [6, 2, 1, "", "failsafe_boot_entry_requested"], [6, 2, 1, "", "get_boot_cmdline"], [6, 2, 1, "", "get_boot_path"], [6, 2, 1, "", "get_boot_theme"], [6, 2, 1, "", "get_boot_timeout_seconds"], [6, 2, 1, "", "get_continue_on_timeout"], [6, 2, 1, "", "get_gfxmode"], [6, 2, 1, "", "get_install_image_boot_default"], [6, 2, 1, "", "get_menu_entry_install_title"], [6, 2, 1, "", "get_menu_entry_title"], [6, 2, 1, "", "post_init"], [6, 2, 1, "", "quote_title"], [6, 2, 1, "", "setup_disk_boot_images"], [6, 2, 1, "", "setup_disk_image_config"], [6, 2, 1, "", "setup_install_boot_images"], [6, 2, 1, "", "setup_install_image_config"], [6, 2, 1, "", "setup_live_boot_images"], [6, 2, 1, "", "setup_live_image_config"], [6, 2, 1, "", "setup_sysconfig_bootloader"], [6, 2, 1, "", "write"], [6, 2, 1, "", "write_meta_data"]], "kiwi.bootloader.config.grub2": [[6, 1, 1, "", "BootLoaderConfigGrub2"]], "kiwi.bootloader.config.grub2.BootLoaderConfigGrub2": [[6, 2, 1, "", "post_init"], [6, 2, 1, "", "setup_disk_boot_images"], [6, 2, 1, "", "setup_disk_image_config"], [6, 2, 1, "", "setup_install_boot_images"], [6, 2, 1, "", "setup_install_image_config"], [6, 2, 1, "", "setup_live_boot_images"], [6, 2, 1, "", "setup_live_image_config"], [6, 2, 1, "", "setup_sysconfig_bootloader"], [6, 2, 1, "", "write"], [6, 2, 1, "", "write_meta_data"]], "kiwi.bootloader.config.systemd_boot": [[6, 1, 1, "", "BootLoaderSystemdBoot"]], "kiwi.bootloader.config.systemd_boot.BootLoaderSystemdBoot": [[6, 2, 1, "", "create_loader_image"], [6, 2, 1, "", "set_loader_entry"], [6, 2, 1, "", "setup_loader"]], "kiwi.bootloader.config.zipl": [[6, 1, 1, "", "BootLoaderZipl"]], "kiwi.bootloader.config.zipl.BootLoaderZipl": [[6, 2, 1, "", "create_loader_image"], [6, 2, 1, "", "set_loader_entry"], [6, 2, 1, "", "setup_loader"]], "kiwi.bootloader.install": [[7, 1, 1, "", "BootLoaderInstall"], [7, 0, 0, "-", "base"], [7, 0, 0, "-", "grub2"], [7, 0, 0, "-", "systemd_boot"], [7, 0, 0, "-", "zipl"]], "kiwi.bootloader.install.BootLoaderInstall": [[7, 2, 1, "", "new"]], "kiwi.bootloader.install.base": [[7, 1, 1, "", "BootLoaderInstallBase"]], "kiwi.bootloader.install.base.BootLoaderInstallBase": [[7, 2, 1, "", "install"], [7, 2, 1, "", "install_required"], [7, 2, 1, "", "post_init"], [7, 2, 1, "", "secure_boot_install"]], "kiwi.bootloader.install.grub2": [[7, 1, 1, "", "BootLoaderInstallGrub2"]], "kiwi.bootloader.install.grub2.BootLoaderInstallGrub2": [[7, 2, 1, "", "install"], [7, 2, 1, "", "install_required"], [7, 2, 1, "", "post_init"], [7, 2, 1, "", "secure_boot_install"], [7, 2, 1, "", "set_disk_password"]], "kiwi.bootloader.install.systemd_boot": [[7, 1, 1, "", "BootLoaderInstallSystemdBoot"]], "kiwi.bootloader.install.systemd_boot.BootLoaderInstallSystemdBoot": [[7, 2, 1, "", "install_required"], [7, 2, 1, "", "post_init"], [7, 2, 1, "", "secure_boot_install"]], "kiwi.bootloader.install.zipl": [[7, 1, 1, "", "BootLoaderInstallZipl"]], "kiwi.bootloader.install.zipl.BootLoaderInstallZipl": [[7, 2, 1, "", "install_required"], [7, 2, 1, "", "post_init"], [7, 2, 1, "", "secure_boot_install"]], "kiwi.bootloader.template": [[8, 0, 0, "-", "grub2"]], "kiwi.bootloader.template.grub2": [[8, 1, 1, "", "BootLoaderTemplateGrub2"]], "kiwi.bootloader.template.grub2.BootLoaderTemplateGrub2": [[8, 2, 1, "", "get_install_template"], [8, 2, 1, "", "get_iso_template"], [8, 2, 1, "", "get_multiboot_install_template"], [8, 2, 1, "", "get_multiboot_iso_template"]], "kiwi.builder": [[9, 1, 1, "", "ImageBuilder"], [9, 0, 0, "-", "archive"], [9, 0, 0, "-", "container"], [9, 0, 0, "-", "disk"], [9, 0, 0, "-", "filesystem"], [9, 0, 0, "-", "install"], [9, 0, 0, "-", "kis"], [9, 0, 0, "-", "live"]], "kiwi.builder.ImageBuilder": [[9, 2, 1, "", "new"]], "kiwi.builder.archive": [[9, 1, 1, "", "ArchiveBuilder"]], "kiwi.builder.archive.ArchiveBuilder": [[9, 2, 1, "", "create"]], "kiwi.builder.container": [[9, 1, 1, "", "ContainerBuilder"]], "kiwi.builder.container.ContainerBuilder": [[9, 2, 1, "", "create"]], "kiwi.builder.disk": [[9, 1, 1, "", "DiskBuilder"], [9, 1, 1, "", "StorageMap"]], "kiwi.builder.disk.DiskBuilder": [[9, 2, 1, "", "append_unpartitioned_space"], [9, 2, 1, "", "create"], [9, 2, 1, "", "create_disk"], [9, 2, 1, "", "create_disk_format"], [9, 2, 1, "", "create_install_media"]], "kiwi.builder.disk.StorageMap": [[9, 3, 1, "", "integrity_root"], [9, 3, 1, "", "luks_root"], [9, 3, 1, "", "raid_root"], [9, 3, 1, "", "system"], [9, 3, 1, "", "system_boot"], [9, 3, 1, "", "system_custom_parts"], [9, 3, 1, "", "system_efi"], [9, 3, 1, "", "system_spare"]], "kiwi.builder.filesystem": [[9, 1, 1, "", "FileSystemBuilder"]], "kiwi.builder.filesystem.FileSystemBuilder": [[9, 2, 1, "", "create"]], "kiwi.builder.install": [[9, 1, 1, "", "InstallImageBuilder"]], "kiwi.builder.install.InstallImageBuilder": [[9, 2, 1, "", "create_install_iso"], [9, 2, 1, "", "create_install_pxe_archive"]], "kiwi.builder.kis": [[9, 1, 1, "", "KisBuilder"]], "kiwi.builder.kis.KisBuilder": [[9, 2, 1, "", "create"]], "kiwi.builder.live": [[9, 1, 1, "", "LiveImageBuilder"]], "kiwi.builder.live.LiveImageBuilder": [[9, 2, 1, "", "create"]], "kiwi.cli": [[1, 1, 1, "", "Cli"]], "kiwi.cli.Cli": [[1, 2, 1, "", "get_command"], [1, 2, 1, "", "get_command_args"], [1, 2, 1, "", "get_global_args"], [1, 2, 1, "", "get_servicename"], [1, 2, 1, "", "load_command"], [1, 2, 1, "", "show_and_exit_on_help_request"]], "kiwi.command": [[1, 1, 1, "", "Command"], [1, 1, 1, "", "CommandCallT"], [1, 1, 1, "", "CommandT"]], "kiwi.command.Command": [[1, 2, 1, "", "call"], [1, 2, 1, "", "run"]], "kiwi.command.CommandCallT": [[1, 3, 1, "", "error"], [1, 3, 1, "", "error_available"], [1, 3, 1, "", "output"], [1, 3, 1, "", "output_available"], [1, 3, 1, "", "process"]], "kiwi.command.CommandT": [[1, 3, 1, "", "error"], [1, 3, 1, "", "output"], [1, 3, 1, "", "returncode"]], "kiwi.command_process": [[1, 1, 1, "", "CommandIterator"], [1, 1, 1, "", "CommandProcess"]], "kiwi.command_process.CommandIterator": [[1, 2, 1, "", "get_error_code"], [1, 2, 1, "", "get_error_output"], [1, 2, 1, "", "get_pid"], [1, 2, 1, "", "kill"]], "kiwi.command_process.CommandProcess": [[1, 2, 1, "", "create_match_method"], [1, 2, 1, "", "poll"], [1, 2, 1, "", "poll_and_watch"], [1, 2, 1, "", "poll_show_progress"], [1, 2, 1, "", "returncode"]], "kiwi.container": [[10, 1, 1, "", "ContainerImage"], [10, 0, 0, "-", "oci"], [11, 0, 0, "-", "setup"]], "kiwi.container.ContainerImage": [[10, 2, 1, "", "new"]], "kiwi.container.oci": [[10, 1, 1, "", "ContainerImageOCI"], [10, 1, 1, "", "OciConfig"]], "kiwi.container.oci.ContainerImageOCI": [[10, 2, 1, "", "create"]], "kiwi.container.oci.OciConfig": [[10, 3, 1, "", "additional_names"], [10, 3, 1, "", "container_name"], [10, 3, 1, "", "container_tag"], [10, 3, 1, "", "entry_command"], [10, 3, 1, "", "entry_subcommand"], [10, 3, 1, "", "environment"], [10, 3, 1, "", "expose_ports"], [10, 3, 1, "", "history"], [10, 3, 1, "", "labels"], [10, 3, 1, "", "maintainer"], [10, 3, 1, "", "user"], [10, 3, 1, "", "volumes"], [10, 3, 1, "", "workingdir"]], "kiwi.container.setup": [[11, 1, 1, "", "ContainerSetup"], [11, 0, 0, "-", "base"], [11, 0, 0, "-", "docker"]], "kiwi.container.setup.ContainerSetup": [[11, 2, 1, "", "new"]], "kiwi.container.setup.base": [[11, 1, 1, "", "ContainerSetupBase"]], "kiwi.container.setup.base.ContainerSetupBase": [[11, 2, 1, "", "deactivate_bootloader_setup"], [11, 2, 1, "", "deactivate_root_filesystem_check"], [11, 2, 1, "", "deactivate_systemd_service"], [11, 2, 1, "", "get_container_name"], [11, 2, 1, "", "post_init"], [11, 2, 1, "", "setup"], [11, 2, 1, "", "setup_root_console"]], "kiwi.container.setup.docker": [[11, 1, 1, "", "ContainerSetupDocker"]], "kiwi.defaults": [[1, 1, 1, "", "Defaults"], [1, 1, 1, "", "grub_loader_type"], [1, 1, 1, "", "shim_loader_type"], [1, 1, 1, "", "unit_type"]], "kiwi.defaults.Defaults": [[1, 2, 1, "", "get"], [1, 2, 1, "", "get_archive_image_types"], [1, 2, 1, "", "get_bios_image_name"], [1, 2, 1, "", "get_bios_module_directory_name"], [1, 2, 1, "", "get_bls_loader_entries_dir"], [1, 2, 1, "", "get_boot_image_description_path"], [1, 2, 1, "", "get_boot_image_strip_file"], [1, 2, 1, "", "get_buildservice_env_name"], [1, 2, 1, "", "get_common_functions_file"], [1, 2, 1, "", "get_container_base_image_tag"], [1, 2, 1, "", "get_container_compression"], [1, 2, 1, "", "get_container_image_types"], [1, 2, 1, "", "get_custom_rpm_bootstrap_macro_name"], [1, 2, 1, "", "get_custom_rpm_image_macro_name"], [1, 2, 1, "", "get_custom_rpm_macros_path"], [1, 2, 1, "", "get_default_boot_mbytes"], [1, 2, 1, "", "get_default_boot_timeout_seconds"], [1, 2, 1, "", "get_default_bootloader"], [1, 2, 1, "", "get_default_container_created_by"], [1, 2, 1, "", "get_default_container_name"], [1, 2, 1, "", "get_default_container_subcommand"], [1, 2, 1, "", "get_default_container_tag"], [1, 2, 1, "", "get_default_disk_start_sector"], [1, 2, 1, "", "get_default_efi_boot_mbytes"], [1, 2, 1, "", "get_default_efi_partition_table_type"], [1, 2, 1, "", "get_default_firmware"], [1, 2, 1, "", "get_default_inode_size"], [1, 2, 1, "", "get_default_legacy_bios_mbytes"], [1, 2, 1, "", "get_default_live_iso_root_filesystem"], [1, 2, 1, "", "get_default_live_iso_type"], [1, 2, 1, "", "get_default_package_manager"], [1, 2, 1, "", "get_default_packager_tool"], [1, 2, 1, "", "get_default_prep_mbytes"], [1, 2, 1, "", "get_default_uri_type"], [1, 2, 1, "", "get_default_video_mode"], [1, 2, 1, "", "get_default_volume_group_name"], [1, 2, 1, "", "get_discoverable_partition_ids"], [1, 2, 1, "", "get_disk_format_types"], [1, 2, 1, "", "get_disk_image_types"], [1, 2, 1, "", "get_dracut_conf_name"], [1, 2, 1, "", "get_ec2_capable_firmware_names"], [1, 2, 1, "", "get_efi_capable_firmware_names"], [1, 2, 1, "", "get_efi_image_name"], [1, 2, 1, "", "get_efi_module_directory_name"], [1, 2, 1, "", "get_efi_vendor_directory"], [1, 2, 1, "", "get_enclaves_image_types"], [1, 2, 1, "", "get_exclude_list_for_non_physical_devices"], [1, 2, 1, "", "get_exclude_list_for_removed_files_detection"], [1, 2, 1, "", "get_exclude_list_for_root_data_sync"], [1, 2, 1, "", "get_exclude_list_from_custom_exclude_files"], [1, 2, 1, "", "get_failsafe_kernel_options"], [1, 2, 1, "", "get_filesystem_image_types"], [1, 2, 1, "", "get_firmware_types"], [1, 2, 1, "", "get_grub_basic_modules"], [1, 2, 1, "", "get_grub_bios_core_loader"], [1, 2, 1, "", "get_grub_bios_modules"], [1, 2, 1, "", "get_grub_boot_directory_name"], [1, 2, 1, "", "get_grub_custom_arguments"], [1, 2, 1, "", "get_grub_efi_font_directory"], [1, 2, 1, "", "get_grub_efi_modules"], [1, 2, 1, "", "get_grub_ofw_modules"], [1, 2, 1, "", "get_grub_path"], [1, 2, 1, "", "get_grub_s390_modules"], [1, 2, 1, "", "get_imported_root_image"], [1, 2, 1, "", "get_install_volume_id"], [1, 2, 1, "", "get_iso_boot_path"], [1, 2, 1, "", "get_iso_grub_loader"], [1, 2, 1, "", "get_iso_grub_mbr"], [1, 2, 1, "", "get_iso_media_tag_tool"], [1, 2, 1, "", "get_iso_tool_category"], [1, 2, 1, "", "get_kis_image_types"], [1, 2, 1, "", "get_live_dracut_modules_from_flag"], [1, 2, 1, "", "get_live_image_types"], [1, 2, 1, "", "get_live_iso_persistent_boot_options"], [1, 2, 1, "", "get_luks_key_length"], [1, 2, 1, "", "get_lvm_overhead_mbytes"], [1, 2, 1, "", "get_min_partition_mbytes"], [1, 2, 1, "", "get_min_volume_mbytes"], [1, 2, 1, "", "get_mok_manager"], [1, 2, 1, "", "get_obs_api_server_url"], [1, 2, 1, "", "get_obs_download_server_url"], [1, 2, 1, "", "get_oci_archive_tool"], [1, 2, 1, "", "get_part_mapper_tool"], [1, 2, 1, "", "get_platform_name"], [1, 2, 1, "", "get_preparer"], [1, 2, 1, "", "get_profile_file"], [1, 2, 1, "", "get_publisher"], [1, 2, 1, "", "get_recovery_spare_mbytes"], [1, 2, 1, "", "get_removed_files_name"], [1, 2, 1, "", "get_runtime_checker_metadata"], [1, 2, 1, "", "get_schema_file"], [1, 2, 1, "", "get_schematron_module_name"], [1, 2, 1, "", "get_shared_cache_location"], [1, 2, 1, "", "get_shim_loader"], [1, 2, 1, "", "get_shim_vendor_directory"], [1, 2, 1, "", "get_signed_grub_loader"], [1, 2, 1, "", "get_snapper_config_template_file"], [1, 2, 1, "", "get_solvable_location"], [1, 2, 1, "", "get_swapsize_mbytes"], [1, 2, 1, "", "get_sync_options"], [1, 2, 1, "", "get_temp_location"], [1, 2, 1, "", "get_unsigned_grub_loader"], [1, 2, 1, "", "get_vagrant_config_virtualbox_guest_additions"], [1, 2, 1, "", "get_vendor_grubenv"], [1, 2, 1, "", "get_video_mode_map"], [1, 2, 1, "", "get_volume_id"], [1, 2, 1, "", "get_xsl_stylesheet_file"], [1, 2, 1, "", "get_xz_compression_options"], [1, 2, 1, "", "is_buildservice_worker"], [1, 2, 1, "", "is_ppc64_arch"], [1, 2, 1, "", "is_x86_arch"], [1, 2, 1, "", "project_file"], [1, 2, 1, "", "set_custom_runtime_config_file"], [1, 2, 1, "", "set_platform_name"], [1, 2, 1, "", "set_runtime_checker_metadata"], [1, 2, 1, "", "set_shared_cache_location"], [1, 2, 1, "", "set_temp_location"], [1, 2, 1, "", "to_profile"]], "kiwi.defaults.grub_loader_type": [[1, 3, 1, "", "binaryname"], [1, 3, 1, "", "filename"]], "kiwi.defaults.shim_loader_type": [[1, 3, 1, "", "binaryname"], [1, 3, 1, "", "filename"]], "kiwi.defaults.unit_type": [[1, 3, 1, "", "byte"], [1, 3, 1, "", "gb"], [1, 3, 1, "", "kb"], [1, 3, 1, "", "mb"]], "kiwi.exceptions": [[1, 5, 1, "", "KiwiAnyMarkupPluginError"], [1, 5, 1, "", "KiwiArchiveSetupError"], [1, 5, 1, "", "KiwiArchiveTarError"], [1, 5, 1, "", "KiwiBootImageSetupError"], [1, 5, 1, "", "KiwiBootLoaderConfigSetupError"], [1, 5, 1, "", "KiwiBootLoaderDiskPasswordError"], [1, 5, 1, "", "KiwiBootLoaderGrubDataError"], [1, 5, 1, "", "KiwiBootLoaderGrubFontError"], [1, 5, 1, "", "KiwiBootLoaderGrubInstallError"], [1, 5, 1, "", "KiwiBootLoaderGrubModulesError"], [1, 5, 1, "", "KiwiBootLoaderGrubPlatformError"], [1, 5, 1, "", "KiwiBootLoaderGrubSecureBootError"], [1, 5, 1, "", "KiwiBootLoaderInstallSetupError"], [1, 5, 1, "", "KiwiBootLoaderTargetError"], [1, 5, 1, "", "KiwiBootLoaderZiplInstallError"], [1, 5, 1, "", "KiwiBootLoaderZiplPlatformError"], [1, 5, 1, "", "KiwiBootLoaderZiplSetupError"], [1, 5, 1, "", "KiwiBootStrapPhaseFailed"], [1, 5, 1, "", "KiwiBuildahError"], [1, 5, 1, "", "KiwiBundleError"], [1, 5, 1, "", "KiwiCommandCapabilitiesError"], [1, 5, 1, "", "KiwiCommandError"], [1, 5, 1, "", "KiwiCommandNotFound"], [1, 5, 1, "", "KiwiCommandNotLoaded"], [1, 5, 1, "", "KiwiCompressionFormatUnknown"], [1, 5, 1, "", "KiwiConfigFileFormatNotSupported"], [1, 5, 1, "", "KiwiConfigFileNotFound"], [1, 5, 1, "", "KiwiContainerBuilderError"], [1, 5, 1, "", "KiwiContainerImageSetupError"], [1, 5, 1, "", "KiwiContainerSetupError"], [1, 5, 1, "", "KiwiCredentialsError"], [1, 5, 1, "", "KiwiCustomPartitionConflictError"], [1, 5, 1, "", "KiwiDataStructureError"], [1, 5, 1, "", "KiwiDebianBootstrapError"], [1, 5, 1, "", "KiwiDecodingError"], [1, 5, 1, "", "KiwiDescriptionInvalid"], [1, 5, 1, "", "KiwiDeviceProviderError"], [1, 5, 1, "", "KiwiDiskBootImageError"], [1, 5, 1, "", "KiwiDiskFormatSetupError"], [1, 5, 1, "", "KiwiDiskGeometryError"], [1, 5, 1, "", "KiwiDistributionNameError"], [1, 5, 1, "", "KiwiEnclaveBootImageError"], [1, 5, 1, "", "KiwiEnclaveFormatError"], [1, 5, 1, "", "KiwiError"], [1, 5, 1, "", "KiwiExtensionError"], [1, 5, 1, "", "KiwiFileAccessError"], [1, 5, 1, "", "KiwiFileNotFound"], [1, 5, 1, "", "KiwiFileSystemSetupError"], [1, 5, 1, "", "KiwiFileSystemSyncError"], [1, 5, 1, "", "KiwiFormatSetupError"], [1, 5, 1, "", "KiwiHelpNoCommandGiven"], [1, 5, 1, "", "KiwiImageResizeError"], [1, 5, 1, "", "KiwiImportDescriptionError"], [1, 5, 1, "", "KiwiIncludFileNotFoundError"], [1, 5, 1, "", "KiwiInstallBootImageError"], [1, 5, 1, "", "KiwiInstallMediaError"], [1, 5, 1, "", "KiwiInstallPhaseFailed"], [1, 5, 1, "", "KiwiIsoMetaDataError"], [1, 5, 1, "", "KiwiIsoToolError"], [1, 5, 1, "", "KiwiKernelLookupError"], [1, 5, 1, "", "KiwiKisBootImageError"], [1, 5, 1, "", "KiwiLiveBootImageError"], [1, 5, 1, "", "KiwiLoadCommandUndefined"], [1, 5, 1, "", "KiwiLogFileSetupFailed"], [1, 5, 1, "", "KiwiLogSocketSetupFailed"], [1, 5, 1, "", "KiwiLoopSetupError"], [1, 5, 1, "", "KiwiLuksSetupError"], [1, 5, 1, "", "KiwiMappedDeviceError"], [1, 5, 1, "", "KiwiMarkupConversionError"], [1, 5, 1, "", "KiwiMountKernelFileSystemsError"], [1, 5, 1, "", "KiwiMountSharedDirectoryError"], [1, 5, 1, "", "KiwiNotImplementedError"], [1, 5, 1, "", "KiwiOCIArchiveToolError"], [1, 5, 1, "", "KiwiOSReleaseImportError"], [1, 5, 1, "", "KiwiOffsetError"], [1, 5, 1, "", "KiwiPackageManagerSetupError"], [1, 5, 1, "", "KiwiPackagesDeletePhaseFailed"], [1, 5, 1, "", "KiwiPartitionTooSmallError"], [1, 5, 1, "", "KiwiPartitionerGptFlagError"], [1, 5, 1, "", "KiwiPartitionerMsDosFlagError"], [1, 5, 1, "", "KiwiPartitionerSetupError"], [1, 5, 1, "", "KiwiPrivilegesError"], [1, 5, 1, "", "KiwiProfileNotFound"], [1, 5, 1, "", "KiwiRaidSetupError"], [1, 5, 1, "", "KiwiRepositorySetupError"], [1, 5, 1, "", "KiwiRequestError"], [1, 5, 1, "", "KiwiRequestedTypeError"], [1, 5, 1, "", "KiwiResizeRawDiskError"], [1, 5, 1, "", "KiwiResultError"], [1, 5, 1, "", "KiwiRootDirExists"], [1, 5, 1, "", "KiwiRootImportError"], [1, 5, 1, "", "KiwiRootInitCreationError"], [1, 5, 1, "", "KiwiRpmDirNotRemoteError"], [1, 5, 1, "", "KiwiRuntimeConfigFileError"], [1, 5, 1, "", "KiwiRuntimeConfigFormatError"], [1, 5, 1, "", "KiwiRuntimeError"], [1, 5, 1, "", "KiwiSatSolverJobError"], [1, 5, 1, "", "KiwiSatSolverJobProblems"], [1, 5, 1, "", "KiwiSatSolverPluginError"], [1, 5, 1, "", "KiwiSchemaImportError"], [1, 5, 1, "", "KiwiScriptFailed"], [1, 5, 1, "", "KiwiSetupIntermediateConfigError"], [1, 5, 1, "", "KiwiShellVariableValueError"], [1, 5, 1, "", "KiwiSizeError"], [1, 5, 1, "", "KiwiSolverRepositorySetupError"], [1, 5, 1, "", "KiwiSystemDeletePackagesFailed"], [1, 5, 1, "", "KiwiSystemInstallPackagesFailed"], [1, 5, 1, "", "KiwiSystemUpdateFailed"], [1, 5, 1, "", "KiwiTargetDirectoryNotFound"], [1, 5, 1, "", "KiwiTemplateError"], [1, 5, 1, "", "KiwiTypeNotFound"], [1, 5, 1, "", "KiwiUmountBusyError"], [1, 5, 1, "", "KiwiUnknownServiceName"], [1, 5, 1, "", "KiwiUriOpenError"], [1, 5, 1, "", "KiwiUriStyleUnknown"], [1, 5, 1, "", "KiwiUriTypeUnknown"], [1, 5, 1, "", "KiwiValidationError"], [1, 5, 1, "", "KiwiVhdTagError"], [1, 5, 1, "", "KiwiVolumeGroupConflict"], [1, 5, 1, "", "KiwiVolumeManagerSetupError"], [1, 5, 1, "", "KiwiVolumeRootIDError"], [1, 5, 1, "", "KiwiVolumeTooSmallError"]], "kiwi.filesystem": [[12, 1, 1, "", "FileSystem"], [12, 0, 0, "-", "base"], [12, 0, 0, "-", "btrfs"], [12, 0, 0, "-", "ext2"], [12, 0, 0, "-", "ext3"], [12, 0, 0, "-", "ext4"], [12, 0, 0, "-", "fat16"], [12, 0, 0, "-", "fat32"], [12, 0, 0, "-", "isofs"], [12, 0, 0, "-", "setup"], [12, 0, 0, "-", "squashfs"], [12, 0, 0, "-", "xfs"]], "kiwi.filesystem.FileSystem": [[12, 2, 1, "", "new"]], "kiwi.filesystem.base": [[12, 1, 1, "", "FileSystemBase"]], "kiwi.filesystem.base.FileSystemBase": [[12, 2, 1, "", "create_on_device"], [12, 2, 1, "", "create_on_file"], [12, 2, 1, "", "create_verification_metadata"], [12, 2, 1, "", "create_verity_layer"], [12, 2, 1, "", "get_fstab"], [12, 2, 1, "", "get_mountpoint"], [12, 2, 1, "", "get_root_volume_name"], [12, 2, 1, "", "get_volumes"], [12, 2, 1, "", "mount"], [12, 2, 1, "", "mount_volumes"], [12, 2, 1, "", "post_init"], [12, 2, 1, "", "set_property_readonly_root"], [12, 2, 1, "", "set_uuid"], [12, 2, 1, "", "sync_data"], [12, 2, 1, "", "umount"], [12, 2, 1, "", "umount_volumes"]], "kiwi.filesystem.btrfs": [[12, 1, 1, "", "FileSystemBtrfs"]], "kiwi.filesystem.btrfs.FileSystemBtrfs": [[12, 2, 1, "", "create_on_device"], [12, 2, 1, "", "set_uuid"]], "kiwi.filesystem.ext2": [[12, 1, 1, "", "FileSystemExt2"]], "kiwi.filesystem.ext2.FileSystemExt2": [[12, 2, 1, "", "create_on_device"], [12, 2, 1, "", "set_uuid"]], "kiwi.filesystem.ext3": [[12, 1, 1, "", "FileSystemExt3"]], "kiwi.filesystem.ext3.FileSystemExt3": [[12, 2, 1, "", "create_on_device"], [12, 2, 1, "", "set_uuid"]], "kiwi.filesystem.ext4": [[12, 1, 1, "", "FileSystemExt4"]], "kiwi.filesystem.ext4.FileSystemExt4": [[12, 2, 1, "", "create_on_device"], [12, 2, 1, "", "set_uuid"]], "kiwi.filesystem.fat16": [[12, 1, 1, "", "FileSystemFat16"]], "kiwi.filesystem.fat16.FileSystemFat16": [[12, 2, 1, "", "create_on_device"], [12, 2, 1, "", "set_uuid"]], "kiwi.filesystem.fat32": [[12, 1, 1, "", "FileSystemFat32"]], "kiwi.filesystem.fat32.FileSystemFat32": [[12, 2, 1, "", "create_on_device"], [12, 2, 1, "", "set_uuid"]], "kiwi.filesystem.isofs": [[12, 1, 1, "", "FileSystemIsoFs"]], "kiwi.filesystem.isofs.FileSystemIsoFs": [[12, 2, 1, "", "create_on_file"]], "kiwi.filesystem.setup": [[12, 1, 1, "", "FileSystemSetup"]], "kiwi.filesystem.setup.FileSystemSetup": [[12, 2, 1, "", "get_size_mbytes"]], "kiwi.filesystem.squashfs": [[12, 1, 1, "", "FileSystemSquashFs"]], "kiwi.filesystem.squashfs.FileSystemSquashFs": [[12, 2, 1, "", "create_on_file"]], "kiwi.filesystem.xfs": [[12, 1, 1, "", "FileSystemXfs"]], "kiwi.filesystem.xfs.FileSystemXfs": [[12, 2, 1, "", "create_on_device"], [12, 2, 1, "", "set_uuid"]], "kiwi.firmware": [[1, 1, 1, "", "FirmWare"]], "kiwi.firmware.FirmWare": [[1, 2, 1, "", "bios_mode"], [1, 2, 1, "", "ec2_mode"], [1, 2, 1, "", "efi_mode"], [1, 2, 1, "", "get_efi_partition_size"], [1, 2, 1, "", "get_legacy_bios_partition_size"], [1, 2, 1, "", "get_partition_table_type"], [1, 2, 1, "", "get_prep_partition_size"], [1, 2, 1, "", "legacy_bios_mode"], [1, 2, 1, "", "ofw_mode"], [1, 2, 1, "", "opal_mode"]], "kiwi.help": [[1, 1, 1, "", "Help"]], "kiwi.help.Help": [[1, 2, 1, "", "show"]], "kiwi.iso_tools": [[13, 1, 1, "", "IsoTools"], [13, 0, 0, "-", "base"], [13, 0, 0, "-", "iso"], [13, 0, 0, "-", "xorriso"]], "kiwi.iso_tools.IsoTools": [[13, 2, 1, "", "new"]], "kiwi.iso_tools.base": [[13, 1, 1, "", "IsoToolsBase"]], "kiwi.iso_tools.base.IsoToolsBase": [[13, 2, 1, "", "add_efi_loader_parameters"], [13, 2, 1, "", "create_iso"], [13, 2, 1, "", "get_tool_name"], [13, 2, 1, "", "has_iso_hybrid_capability"], [13, 2, 1, "", "init_iso_creation_parameters"], [13, 2, 1, "", "list_iso"], [13, 2, 1, "", "setup_media_loader_directory"]], "kiwi.iso_tools.iso": [[13, 1, 1, "", "Iso"]], "kiwi.iso_tools.iso.Iso": [[13, 2, 1, "", "set_media_tag"]], "kiwi.iso_tools.xorriso": [[13, 1, 1, "", "IsoToolsXorrIso"]], "kiwi.iso_tools.xorriso.IsoToolsXorrIso": [[13, 2, 1, "", "add_efi_loader_parameters"], [13, 2, 1, "", "create_iso"], [13, 2, 1, "", "get_tool_name"], [13, 2, 1, "", "has_iso_hybrid_capability"], [13, 2, 1, "", "init_iso_creation_parameters"]], "kiwi.kiwi": [[1, 4, 1, "", "extras"], [1, 4, 1, "", "main"], [1, 4, 1, "", "usage"]], "kiwi.logger": [[1, 1, 1, "", "Logger"]], "kiwi.logger.Logger": [[1, 2, 1, "", "getLogFlags"], [1, 2, 1, "", "getLogLevel"], [1, 2, 1, "", "get_logfile"], [1, 2, 1, "", "progress"], [1, 2, 1, "", "setLogFlag"], [1, 2, 1, "", "setLogLevel"], [1, 2, 1, "", "set_color_format"], [1, 2, 1, "", "set_log_socket"], [1, 2, 1, "", "set_logfile"]], "kiwi.logger_color_formatter": [[1, 1, 1, "", "ColorFormatter"], [1, 1, 1, "", "ColorMessage"]], "kiwi.logger_color_formatter.ColorFormatter": [[1, 2, 1, "", "format"]], "kiwi.logger_color_formatter.ColorMessage": [[1, 2, 1, "", "format_message"]], "kiwi.logger_filter": [[1, 1, 1, "", "DebugFilter"], [1, 1, 1, "", "ErrorFilter"], [1, 1, 1, "", "InfoFilter"], [1, 1, 1, "", "LoggerSchedulerFilter"], [1, 1, 1, "", "WarningFilter"]], "kiwi.logger_filter.DebugFilter": [[1, 2, 1, "", "filter"]], "kiwi.logger_filter.ErrorFilter": [[1, 2, 1, "", "filter"]], "kiwi.logger_filter.InfoFilter": [[1, 2, 1, "", "filter"]], "kiwi.logger_filter.LoggerSchedulerFilter": [[1, 2, 1, "", "filter"]], "kiwi.logger_filter.WarningFilter": [[1, 2, 1, "", "filter"]], "kiwi.mount_manager": [[1, 1, 1, "", "MountManager"]], "kiwi.mount_manager.MountManager": [[1, 2, 1, "", "bind_mount"], [1, 2, 1, "", "get_attributes"], [1, 2, 1, "", "is_mounted"], [1, 2, 1, "", "mount"], [1, 2, 1, "", "overlay_mount"], [1, 2, 1, "", "tmpfs_mount"], [1, 2, 1, "", "umount"], [1, 2, 1, "", "umount_lazy"]], "kiwi.package_manager": [[14, 1, 1, "", "PackageManager"], [14, 0, 0, "-", "base"], [14, 0, 0, "-", "dnf4"], [14, 0, 0, "-", "zypper"]], "kiwi.package_manager.PackageManager": [[14, 2, 1, "", "new"]], "kiwi.package_manager.base": [[14, 1, 1, "", "PackageManagerBase"]], "kiwi.package_manager.base.PackageManagerBase": [[14, 2, 1, "", "clean_leftovers"], [14, 2, 1, "", "cleanup_requests"], [14, 2, 1, "", "database_consistent"], [14, 2, 1, "", "dump_reload_package_database"], [14, 2, 1, "", "get_error_details"], [14, 2, 1, "", "has_failed"], [14, 2, 1, "", "match_package_deleted"], [14, 2, 1, "", "match_package_installed"], [14, 2, 1, "", "post_init"], [14, 2, 1, "", "post_process_delete_requests"], [14, 2, 1, "", "post_process_install_requests_bootstrap"], [14, 2, 1, "", "process_delete_requests"], [14, 2, 1, "", "process_install_requests"], [14, 2, 1, "", "process_install_requests_bootstrap"], [14, 2, 1, "", "process_only_required"], [14, 2, 1, "", "process_plus_recommended"], [14, 2, 1, "", "request_collection"], [14, 2, 1, "", "request_package"], [14, 2, 1, "", "request_package_exclusion"], [14, 2, 1, "", "request_package_lock"], [14, 2, 1, "", "request_product"], [14, 2, 1, "", "setup_repository_modules"], [14, 2, 1, "", "update"]], "kiwi.package_manager.dnf4": [[14, 1, 1, "", "PackageManagerDnf4"]], "kiwi.package_manager.dnf4.PackageManagerDnf4": [[14, 2, 1, "", "clean_leftovers"], [14, 2, 1, "", "match_package_deleted"], [14, 2, 1, "", "match_package_installed"], [14, 2, 1, "", "post_init"], [14, 2, 1, "", "post_process_install_requests_bootstrap"], [14, 2, 1, "", "process_delete_requests"], [14, 2, 1, "", "process_install_requests"], [14, 2, 1, "", "process_install_requests_bootstrap"], [14, 2, 1, "", "process_only_required"], [14, 2, 1, "", "process_plus_recommended"], [14, 2, 1, "", "request_collection"], [14, 2, 1, "", "request_package"], [14, 2, 1, "", "request_package_exclusion"], [14, 2, 1, "", "request_product"], [14, 2, 1, "", "setup_repository_modules"], [14, 2, 1, "", "update"]], "kiwi.package_manager.zypper": [[14, 1, 1, "", "PackageManagerZypper"]], "kiwi.package_manager.zypper.PackageManagerZypper": [[14, 2, 1, "", "clean_leftovers"], [14, 2, 1, "", "has_failed"], [14, 2, 1, "", "match_package_deleted"], [14, 2, 1, "", "match_package_installed"], [14, 2, 1, "", "post_init"], [14, 2, 1, "", "post_process_install_requests_bootstrap"], [14, 2, 1, "", "process_delete_requests"], [14, 2, 1, "", "process_install_requests"], [14, 2, 1, "", "process_install_requests_bootstrap"], [14, 2, 1, "", "process_only_required"], [14, 2, 1, "", "process_plus_recommended"], [14, 2, 1, "", "request_collection"], [14, 2, 1, "", "request_package"], [14, 2, 1, "", "request_package_exclusion"], [14, 2, 1, "", "request_product"], [14, 2, 1, "", "setup_repository_modules"], [14, 2, 1, "", "update"]], "kiwi.partitioner": [[15, 1, 1, "", "Partitioner"], [15, 0, 0, "-", "base"], [15, 0, 0, "-", "dasd"], [15, 0, 0, "-", "gpt"], [15, 0, 0, "-", "msdos"]], "kiwi.partitioner.Partitioner": [[15, 2, 1, "", "new"]], "kiwi.partitioner.base": [[15, 1, 1, "", "PartitionerBase"]], "kiwi.partitioner.base.PartitionerBase": [[15, 2, 1, "", "create"], [15, 2, 1, "", "get_id"], [15, 2, 1, "", "post_init"], [15, 2, 1, "", "resize_table"], [15, 2, 1, "", "set_flag"], [15, 2, 1, "", "set_hybrid_mbr"], [15, 2, 1, "", "set_mbr"], [15, 2, 1, "", "set_start_sector"], [15, 2, 1, "", "set_uuid"]], "kiwi.partitioner.dasd": [[15, 1, 1, "", "PartitionerDasd"]], "kiwi.partitioner.dasd.PartitionerDasd": [[15, 2, 1, "", "create"], [15, 2, 1, "", "post_init"], [15, 2, 1, "", "resize_table"], [15, 2, 1, "", "set_uuid"]], "kiwi.partitioner.gpt": [[15, 1, 1, "", "PartitionerGpt"]], "kiwi.partitioner.gpt.PartitionerGpt": [[15, 2, 1, "", "create"], [15, 2, 1, "", "post_init"], [15, 2, 1, "", "resize_table"], [15, 2, 1, "", "set_flag"], [15, 2, 1, "", "set_hybrid_mbr"], [15, 2, 1, "", "set_mbr"], [15, 2, 1, "", "set_uuid"]], "kiwi.partitioner.msdos": [[15, 1, 1, "", "PartitionerMsDos"]], "kiwi.partitioner.msdos.PartitionerMsDos": [[15, 2, 1, "", "create"], [15, 2, 1, "", "post_init"], [15, 2, 1, "", "resize_table"], [15, 2, 1, "", "set_flag"], [15, 2, 1, "", "set_start_sector"], [15, 2, 1, "", "set_uuid"]], "kiwi.path": [[1, 1, 1, "", "Path"]], "kiwi.path.Path": [[1, 2, 1, "", "access"], [1, 2, 1, "", "create"], [1, 2, 1, "", "move_to_root"], [1, 2, 1, "", "rebase_to_root"], [1, 2, 1, "", "remove_hierarchy"], [1, 2, 1, "", "sort_by_hierarchy"], [1, 2, 1, "", "which"], [1, 2, 1, "", "wipe"]], "kiwi.privileges": [[1, 1, 1, "", "Privileges"]], "kiwi.privileges.Privileges": [[1, 2, 1, "", "check_for_root_permissions"]], "kiwi.repository": [[16, 1, 1, "", "Repository"], [16, 0, 0, "-", "base"], [16, 0, 0, "-", "dnf4"], [17, 0, 0, "-", "template"], [16, 0, 0, "-", "zypper"]], "kiwi.repository.Repository": [[16, 2, 1, "", "new"]], "kiwi.repository.base": [[16, 1, 1, "", "RepositoryBase"]], "kiwi.repository.base.RepositoryBase": [[16, 2, 1, "", "add_repo"], [16, 2, 1, "", "cleanup"], [16, 2, 1, "", "cleanup_unused_repos"], [16, 2, 1, "", "delete_all_repos"], [16, 2, 1, "", "delete_repo"], [16, 2, 1, "", "delete_repo_cache"], [16, 2, 1, "", "import_trusted_keys"], [16, 2, 1, "", "post_init"], [16, 2, 1, "", "run_repo_customize"], [16, 2, 1, "", "runtime_config"], [16, 2, 1, "", "setup_package_database_configuration"], [16, 2, 1, "", "use_default_location"]], "kiwi.repository.dnf4": [[16, 1, 1, "", "RepositoryDnf4"]], "kiwi.repository.dnf4.RepositoryDnf4": [[16, 2, 1, "", "add_repo"], [16, 2, 1, "", "cleanup"], [16, 2, 1, "", "cleanup_unused_repos"], [16, 2, 1, "", "delete_all_repos"], [16, 2, 1, "", "delete_repo"], [16, 2, 1, "", "delete_repo_cache"], [16, 2, 1, "", "import_trusted_keys"], [16, 2, 1, "", "post_init"], [16, 2, 1, "", "runtime_config"], [16, 2, 1, "", "setup_package_database_configuration"], [16, 2, 1, "", "use_default_location"]], "kiwi.repository.template": [[17, 0, 0, "-", "apt"]], "kiwi.repository.template.apt": [[17, 1, 1, "", "PackageManagerTemplateAptGet"]], "kiwi.repository.template.apt.PackageManagerTemplateAptGet": [[17, 2, 1, "", "get_host_template"], [17, 2, 1, "", "get_image_template"]], "kiwi.repository.zypper": [[16, 1, 1, "", "RepositoryZypper"]], "kiwi.repository.zypper.RepositoryZypper": [[16, 2, 1, "", "add_repo"], [16, 2, 1, "", "cleanup"], [16, 2, 1, "", "cleanup_unused_repos"], [16, 2, 1, "", "delete_all_repos"], [16, 2, 1, "", "delete_repo"], [16, 2, 1, "", "delete_repo_cache"], [16, 2, 1, "", "import_trusted_keys"], [16, 2, 1, "", "post_init"], [16, 2, 1, "", "runtime_config"], [16, 2, 1, "", "setup_package_database_configuration"], [16, 2, 1, "", "use_default_location"]], "kiwi.runtime_checker": [[1, 1, 1, "", "RuntimeChecker"], [1, 1, 1, "", "dracut_module_type"]], "kiwi.runtime_checker.RuntimeChecker": [[1, 2, 1, "", "check_appx_naming_conventions_valid"], [1, 2, 1, "", "check_boot_description_exists"], [1, 2, 1, "", "check_consistent_kernel_in_boot_and_system_image"], [1, 2, 1, "", "check_container_tool_chain_installed"], [1, 2, 1, "", "check_dracut_module_for_disk_oem_in_package_list"], [1, 2, 1, "", "check_dracut_module_for_disk_overlay_in_package_list"], [1, 2, 1, "", "check_dracut_module_for_live_iso_in_package_list"], [1, 2, 1, "", "check_dracut_module_for_oem_install_in_package_list"], [1, 2, 1, "", "check_dracut_module_versions_compatible_to_kiwi"], [1, 2, 1, "", "check_efi_fat_image_has_correct_size"], [1, 2, 1, "", "check_efi_mode_for_disk_overlay_correctly_setup"], [1, 2, 1, "", "check_image_include_repos_publicly_resolvable"], [1, 2, 1, "", "check_image_type_unique"], [1, 2, 1, "", "check_image_version_provided"], [1, 2, 1, "", "check_include_references_unresolvable"], [1, 2, 1, "", "check_initrd_selection_required"], [1, 2, 1, "", "check_luksformat_options_valid"], [1, 2, 1, "", "check_mediacheck_installed"], [1, 2, 1, "", "check_partuuid_persistency_type_used_with_mbr"], [1, 2, 1, "", "check_repositories_configured"], [1, 2, 1, "", "check_swap_name_used_with_lvm"], [1, 2, 1, "", "check_target_directory_not_in_shared_cache"], [1, 2, 1, "", "check_volume_label_used_with_lvm"], [1, 2, 1, "", "check_volume_setup_defines_multiple_fullsize_volumes"], [1, 2, 1, "", "check_volume_setup_defines_reserved_labels"], [1, 2, 1, "", "check_volume_setup_has_no_root_definition"], [1, 2, 1, "", "check_xen_uniquely_setup_as_server_or_guest"]], "kiwi.runtime_checker.dracut_module_type": [[1, 3, 1, "", "min_version"], [1, 3, 1, "", "package"]], "kiwi.runtime_config": [[1, 1, 1, "", "RuntimeConfig"]], "kiwi.runtime_config.RuntimeConfig": [[1, 2, 1, "", "get_bundle_compression"], [1, 2, 1, "", "get_container_compression"], [1, 2, 1, "", "get_credentials_verification_metadata_signing_key_file"], [1, 2, 1, "", "get_disabled_runtime_checks"], [1, 2, 1, "", "get_iso_media_tag_tool"], [1, 2, 1, "", "get_iso_tool_category"], [1, 2, 1, "", "get_mapper_tool"], [1, 2, 1, "", "get_max_size_constraint"], [1, 2, 1, "", "get_obs_api_credentials"], [1, 2, 1, "", "get_obs_api_server_url"], [1, 2, 1, "", "get_obs_download_server_url"], [1, 2, 1, "", "get_oci_archive_tool"], [1, 2, 1, "", "get_package_changes"], [1, 2, 1, "", "get_xz_options"], [1, 2, 1, "", "is_obs_public"]], "kiwi.solver": [[19, 0, 0, "-", "repository"], [18, 0, 0, "-", "sat"]], "kiwi.solver.repository": [[19, 1, 1, "", "SolverRepository"], [19, 0, 0, "-", "base"], [19, 0, 0, "-", "rpm_dir"], [19, 0, 0, "-", "rpm_md"], [19, 0, 0, "-", "suse"]], "kiwi.solver.repository.SolverRepository": [[19, 2, 1, "", "new"]], "kiwi.solver.repository.base": [[19, 1, 1, "", "SolverRepositoryBase"]], "kiwi.solver.repository.base.SolverRepositoryBase": [[19, 2, 1, "", "create_repository_solvable"], [19, 2, 1, "", "download_from_repository"], [19, 2, 1, "", "get_repo_type"], [19, 2, 1, "", "is_uptodate"], [19, 2, 1, "", "timestamp"]], "kiwi.solver.repository.rpm_dir": [[19, 1, 1, "", "SolverRepositoryRpmDir"]], "kiwi.solver.repository.rpm_md": [[19, 1, 1, "", "SolverRepositoryRpmMd"]], "kiwi.solver.repository.rpm_md.SolverRepositoryRpmMd": [[19, 2, 1, "", "timestamp"]], "kiwi.solver.repository.suse": [[19, 1, 1, "", "SolverRepositorySUSE"]], "kiwi.solver.sat": [[18, 1, 1, "", "Sat"]], "kiwi.solver.sat.Sat": [[18, 2, 1, "", "add_repository"], [18, 2, 1, "", "set_dist_type"], [18, 2, 1, "", "solve"]], "kiwi.storage": [[20, 0, 0, "-", "clone_device"], [20, 0, 0, "-", "device_provider"], [20, 0, 0, "-", "disk"], [20, 0, 0, "-", "loop_device"], [20, 0, 0, "-", "luks_device"], [20, 0, 0, "-", "mapped_device"], [20, 0, 0, "-", "raid_device"], [20, 0, 0, "-", "setup"], [21, 0, 0, "-", "subformat"]], "kiwi.storage.clone_device": [[20, 1, 1, "", "CloneDevice"]], "kiwi.storage.clone_device.CloneDevice": [[20, 2, 1, "", "clone"]], "kiwi.storage.device_provider": [[20, 1, 1, "", "DeviceProvider"]], "kiwi.storage.device_provider.DeviceProvider": [[20, 2, 1, "", "get_byte_size"], [20, 2, 1, "", "get_device"], [20, 2, 1, "", "get_uuid"], [20, 2, 1, "", "is_loop"]], "kiwi.storage.disk": [[20, 1, 1, "", "Disk"], [20, 1, 1, "", "ptable_entry_type"]], "kiwi.storage.disk.Disk": [[20, 2, 1, "", "activate_boot_partition"], [20, 2, 1, "", "create_boot_partition"], [20, 2, 1, "", "create_custom_partitions"], [20, 2, 1, "", "create_efi_csm_partition"], [20, 2, 1, "", "create_efi_partition"], [20, 2, 1, "", "create_hybrid_mbr"], [20, 2, 1, "", "create_mbr"], [20, 2, 1, "", "create_prep_partition"], [20, 2, 1, "", "create_root_lvm_partition"], [20, 2, 1, "", "create_root_partition"], [20, 2, 1, "", "create_root_raid_partition"], [20, 2, 1, "", "create_root_readonly_partition"], [20, 2, 1, "", "create_spare_partition"], [20, 2, 1, "", "create_swap_partition"], [20, 3, 1, "", "gUID"], [20, 2, 1, "", "get_device"], [20, 2, 1, "", "get_discoverable_partition_ids"], [20, 2, 1, "", "get_public_partition_id_map"], [20, 2, 1, "", "is_loop"], [20, 2, 1, "", "map_partitions"], [20, 3, 1, "", "protected_map_ids"], [20, 2, 1, "", "set_start_sector"], [20, 3, 1, "", "storage_provider"], [20, 2, 1, "", "wipe"]], "kiwi.storage.disk.ptable_entry_type": [[20, 3, 1, "", "clone"], [20, 3, 1, "", "filesystem"], [20, 3, 1, "", "mbsize"], [20, 3, 1, "", "mountpoint"], [20, 3, 1, "", "partition_name"], [20, 3, 1, "", "partition_type"]], "kiwi.storage.loop_device": [[20, 1, 1, "", "LoopDevice"]], "kiwi.storage.loop_device.LoopDevice": [[20, 2, 1, "", "create"], [20, 2, 1, "", "get_device"], [20, 2, 1, "", "is_loop"]], "kiwi.storage.luks_device": [[20, 1, 1, "", "LuksDevice"]], "kiwi.storage.luks_device.LuksDevice": [[20, 2, 1, "", "create_crypto_luks"], [20, 2, 1, "", "create_crypttab"], [20, 2, 1, "", "create_random_keyfile"], [20, 2, 1, "", "get_device"], [20, 2, 1, "", "is_loop"], [20, 3, 1, "", "storage_provider"]], "kiwi.storage.mapped_device": [[20, 1, 1, "", "MappedDevice"]], "kiwi.storage.mapped_device.MappedDevice": [[20, 2, 1, "", "get_device"], [20, 2, 1, "", "is_loop"]], "kiwi.storage.raid_device": [[20, 1, 1, "", "RaidDevice"]], "kiwi.storage.raid_device.RaidDevice": [[20, 2, 1, "", "create_degraded_raid"], [20, 2, 1, "", "create_raid_config"], [20, 2, 1, "", "get_device"], [20, 2, 1, "", "is_loop"], [20, 3, 1, "", "storage_provider"]], "kiwi.storage.setup": [[20, 1, 1, "", "DiskSetup"]], "kiwi.storage.setup.DiskSetup": [[20, 2, 1, "", "boot_partition_size"], [20, 2, 1, "", "get_boot_label"], [20, 2, 1, "", "get_disksize_mbytes"], [20, 2, 1, "", "get_efi_label"], [20, 2, 1, "", "get_root_label"], [20, 2, 1, "", "need_boot_partition"]], "kiwi.storage.subformat": [[21, 1, 1, "", "DiskFormat"], [21, 0, 0, "-", "base"], [21, 0, 0, "-", "gce"], [21, 0, 0, "-", "ova"], [21, 0, 0, "-", "qcow2"], [22, 0, 0, "-", "template"], [21, 0, 0, "-", "vagrant_base"], [21, 0, 0, "-", "vagrant_libvirt"], [21, 0, 0, "-", "vagrant_virtualbox"], [21, 0, 0, "-", "vdi"], [21, 0, 0, "-", "vhd"], [21, 0, 0, "-", "vhdfixed"], [21, 0, 0, "-", "vhdx"], [21, 0, 0, "-", "vmdk"]], "kiwi.storage.subformat.DiskFormat": [[21, 2, 1, "", "new"]], "kiwi.storage.subformat.base": [[21, 1, 1, "", "DiskFormatBase"]], "kiwi.storage.subformat.base.DiskFormatBase": [[21, 2, 1, "", "create_image_format"], [21, 2, 1, "", "get_qemu_option_list"], [21, 2, 1, "", "get_target_file_path_for_format"], [21, 2, 1, "", "has_raw_disk"], [21, 2, 1, "", "post_init"], [21, 2, 1, "", "resize_raw_disk"], [21, 2, 1, "", "store_to_result"]], "kiwi.storage.subformat.gce": [[21, 1, 1, "", "DiskFormatGce"]], "kiwi.storage.subformat.gce.DiskFormatGce": [[21, 2, 1, "", "create_image_format"], [21, 2, 1, "", "get_target_file_path_for_format"], [21, 2, 1, "", "post_init"], [21, 2, 1, "", "store_to_result"]], "kiwi.storage.subformat.ova": [[21, 1, 1, "", "DiskFormatOva"]], "kiwi.storage.subformat.ova.DiskFormatOva": [[21, 2, 1, "", "create_image_format"], [21, 2, 1, "", "post_init"], [21, 2, 1, "", "store_to_result"]], "kiwi.storage.subformat.qcow2": [[21, 1, 1, "", "DiskFormatQcow2"]], "kiwi.storage.subformat.qcow2.DiskFormatQcow2": [[21, 2, 1, "", "create_image_format"], [21, 2, 1, "", "post_init"], [21, 2, 1, "", "store_to_result"]], "kiwi.storage.subformat.template": [[22, 0, 0, "-", "vagrant_config"], [22, 0, 0, "-", "virtualbox_ovf"], [22, 0, 0, "-", "vmware_settings"]], "kiwi.storage.subformat.template.vagrant_config": [[22, 1, 1, "", "VagrantConfigTemplate"]], "kiwi.storage.subformat.template.vagrant_config.VagrantConfigTemplate": [[22, 2, 1, "", "get_template"]], "kiwi.storage.subformat.template.virtualbox_ovf": [[22, 1, 1, "", "VirtualboxOvfTemplate"]], "kiwi.storage.subformat.template.virtualbox_ovf.VirtualboxOvfTemplate": [[22, 2, 1, "", "get_template"]], "kiwi.storage.subformat.template.vmware_settings": [[22, 1, 1, "", "VmwareSettingsTemplate"]], "kiwi.storage.subformat.template.vmware_settings.VmwareSettingsTemplate": [[22, 2, 1, "", "get_template"]], "kiwi.storage.subformat.vagrant_base": [[21, 1, 1, "", "DiskFormatVagrantBase"]], "kiwi.storage.subformat.vagrant_base.DiskFormatVagrantBase": [[21, 2, 1, "", "create_box_img"], [21, 2, 1, "", "create_image_format"], [21, 2, 1, "", "get_additional_metadata"], [21, 2, 1, "", "get_additional_vagrant_config_settings"], [21, 2, 1, "", "post_init"], [21, 2, 1, "", "store_to_result"], [21, 2, 1, "", "vagrant_post_init"]], "kiwi.storage.subformat.vagrant_libvirt": [[21, 1, 1, "", "DiskFormatVagrantLibVirt"]], "kiwi.storage.subformat.vagrant_libvirt.DiskFormatVagrantLibVirt": [[21, 2, 1, "", "create_box_img"], [21, 2, 1, "", "get_additional_metadata"], [21, 2, 1, "", "get_additional_vagrant_config_settings"], [21, 2, 1, "", "vagrant_post_init"]], "kiwi.storage.subformat.vagrant_virtualbox": [[21, 1, 1, "", "DiskFormatVagrantVirtualBox"]], "kiwi.storage.subformat.vagrant_virtualbox.DiskFormatVagrantVirtualBox": [[21, 2, 1, "", "create_box_img"], [21, 2, 1, "", "get_additional_vagrant_config_settings"], [21, 2, 1, "", "vagrant_post_init"]], "kiwi.storage.subformat.vdi": [[21, 1, 1, "", "DiskFormatVdi"]], "kiwi.storage.subformat.vdi.DiskFormatVdi": [[21, 2, 1, "", "create_image_format"], [21, 2, 1, "", "post_init"]], "kiwi.storage.subformat.vhd": [[21, 1, 1, "", "DiskFormatVhd"]], "kiwi.storage.subformat.vhd.DiskFormatVhd": [[21, 2, 1, "", "create_image_format"], [21, 2, 1, "", "post_init"]], "kiwi.storage.subformat.vhdfixed": [[21, 1, 1, "", "DiskFormatVhdFixed"]], "kiwi.storage.subformat.vhdfixed.DiskFormatVhdFixed": [[21, 2, 1, "", "create_image_format"], [21, 2, 1, "", "post_init"], [21, 2, 1, "", "store_to_result"]], "kiwi.storage.subformat.vhdx": [[21, 1, 1, "", "DiskFormatVhdx"]], "kiwi.storage.subformat.vhdx.DiskFormatVhdx": [[21, 2, 1, "", "create_image_format"], [21, 2, 1, "", "post_init"]], "kiwi.storage.subformat.vmdk": [[21, 1, 1, "", "DiskFormatVmdk"]], "kiwi.storage.subformat.vmdk.DiskFormatVmdk": [[21, 2, 1, "", "create_image_format"], [21, 2, 1, "", "post_init"], [21, 2, 1, "", "store_to_result"]], "kiwi.system": [[23, 0, 0, "-", "identifier"], [23, 0, 0, "-", "kernel"], [23, 0, 0, "-", "prepare"], [23, 0, 0, "-", "profile"], [23, 0, 0, "-", "result"], [23, 0, 0, "-", "root_bind"], [23, 0, 0, "-", "root_init"], [23, 0, 0, "-", "setup"], [23, 0, 0, "-", "shell"], [23, 0, 0, "-", "size"], [23, 0, 0, "-", "uri"], [23, 0, 0, "-", "users"]], "kiwi.system.identifier": [[23, 1, 1, "", "SystemIdentifier"]], "kiwi.system.identifier.SystemIdentifier": [[23, 2, 1, "", "calculate_id"], [23, 2, 1, "", "get_id"], [23, 2, 1, "", "write"], [23, 2, 1, "", "write_to_disk"]], "kiwi.system.kernel": [[23, 1, 1, "", "Kernel"], [23, 1, 1, "", "kernel_type"], [23, 1, 1, "", "xen_hypervisor_type"]], "kiwi.system.kernel.Kernel": [[23, 2, 1, "", "copy_kernel"], [23, 2, 1, "", "copy_xen_hypervisor"], [23, 2, 1, "", "get_kernel"], [23, 2, 1, "", "get_xen_hypervisor"]], "kiwi.system.kernel.kernel_type": [[23, 3, 1, "", "filename"], [23, 3, 1, "", "name"], [23, 3, 1, "", "version"]], "kiwi.system.kernel.xen_hypervisor_type": [[23, 3, 1, "", "filename"], [23, 3, 1, "", "name"]], "kiwi.system.prepare": [[23, 1, 1, "", "SystemPrepare"]], "kiwi.system.prepare.SystemPrepare": [[23, 2, 1, "", "clean_package_manager_leftovers"], [23, 2, 1, "", "delete_packages"], [23, 2, 1, "", "install_bootstrap"], [23, 2, 1, "", "install_packages"], [23, 2, 1, "", "install_system"], [23, 2, 1, "", "pinch_system"], [23, 2, 1, "", "setup_repositories"], [23, 2, 1, "", "update_system"], [23, 3, 1, "", "uri_list"]], "kiwi.system.profile": [[23, 1, 1, "", "Profile"]], "kiwi.system.profile.Profile": [[23, 2, 1, "", "add"], [23, 2, 1, "", "create"], [23, 2, 1, "", "delete"], [23, 2, 1, "", "get_settings"]], "kiwi.system.result": [[23, 1, 1, "", "Result"], [23, 1, 1, "", "result_file_type"], [23, 1, 1, "", "result_name_tags"]], "kiwi.system.result.Result": [[23, 2, 1, "", "add"], [23, 2, 1, "", "add_bundle_format"], [23, 2, 1, "", "dump"], [23, 2, 1, "", "get_results"], [23, 2, 1, "", "load"], [23, 2, 1, "", "print_results"], [23, 2, 1, "", "verify_image_size"]], "kiwi.system.result.result_file_type": [[23, 3, 1, "", "compress"], [23, 3, 1, "", "filename"], [23, 3, 1, "", "shasum"], [23, 3, 1, "", "use_for_bundle"]], "kiwi.system.result.result_name_tags": [[23, 3, 1, "", "A"], [23, 3, 1, "", "I"], [23, 3, 1, "", "M"], [23, 3, 1, "", "N"], [23, 3, 1, "", "P"], [23, 3, 1, "", "T"], [23, 3, 1, "", "m"], [23, 3, 1, "", "p"], [23, 3, 1, "", "v"]], "kiwi.system.root_bind": [[23, 1, 1, "", "RootBind"]], "kiwi.system.root_bind.RootBind": [[23, 2, 1, "", "cleanup"], [23, 2, 1, "", "mount_kernel_file_systems"], [23, 2, 1, "", "mount_shared_directory"], [23, 2, 1, "", "setup_intermediate_config"], [23, 2, 1, "", "umount_kernel_file_systems"]], "kiwi.system.root_init": [[23, 1, 1, "", "RootInit"]], "kiwi.system.root_init.RootInit": [[23, 2, 1, "", "create"], [23, 2, 1, "", "delete"]], "kiwi.system.setup": [[23, 1, 1, "", "SystemSetup"]], "kiwi.system.setup.SystemSetup": [[23, 2, 1, "", "call_config_host_overlay_script"], [23, 2, 1, "", "call_config_overlay_script"], [23, 2, 1, "", "call_config_script"], [23, 2, 1, "", "call_disk_script"], [23, 2, 1, "", "call_edit_boot_config_script"], [23, 2, 1, "", "call_edit_boot_install_script"], [23, 2, 1, "", "call_image_script"], [23, 2, 1, "", "call_post_bootstrap_script"], [23, 2, 1, "", "call_pre_disk_script"], [23, 2, 1, "", "cleanup"], [23, 2, 1, "", "create_fstab"], [23, 2, 1, "", "create_init_link_from_linuxrc"], [23, 2, 1, "", "create_recovery_archive"], [23, 2, 1, "", "export_modprobe_setup"], [23, 2, 1, "", "export_package_changes"], [23, 2, 1, "", "export_package_list"], [23, 2, 1, "", "export_package_verification"], [23, 2, 1, "", "import_cdroot_files"], [23, 2, 1, "", "import_description"], [23, 2, 1, "", "import_files"], [23, 2, 1, "", "import_image_identifier"], [23, 2, 1, "", "import_overlay_files"], [23, 2, 1, "", "import_repositories_marked_as_imageinclude"], [23, 2, 1, "", "script_exists"], [23, 2, 1, "", "set_selinux_file_contexts"], [23, 2, 1, "", "setup_groups"], [23, 2, 1, "", "setup_keyboard_map"], [23, 2, 1, "", "setup_locale"], [23, 2, 1, "", "setup_machine_id"], [23, 2, 1, "", "setup_permissions"], [23, 2, 1, "", "setup_plymouth_splash"], [23, 2, 1, "", "setup_registry_import"], [23, 2, 1, "", "setup_selinux_file_contexts"], [23, 2, 1, "", "setup_timezone"], [23, 2, 1, "", "setup_users"]], "kiwi.system.shell": [[23, 1, 1, "", "Shell"]], "kiwi.system.shell.Shell": [[23, 2, 1, "", "format_to_variable_value"], [23, 2, 1, "", "quote"], [23, 2, 1, "", "quote_key_value_file"], [23, 2, 1, "", "run_common_function"]], "kiwi.system.size": [[23, 1, 1, "", "SystemSize"]], "kiwi.system.size.SystemSize": [[23, 2, 1, "", "accumulate_files"], [23, 2, 1, "", "accumulate_mbyte_file_sizes"], [23, 2, 1, "", "customize"]], "kiwi.system.uri": [[23, 1, 1, "", "Uri"]], "kiwi.system.uri.Uri": [[23, 2, 1, "", "alias"], [23, 2, 1, "", "credentials_file_name"], [23, 2, 1, "", "get_fragment"], [23, 2, 1, "", "is_public"], [23, 2, 1, "", "is_remote"], [23, 2, 1, "", "print_sensitive"], [23, 2, 1, "", "translate"]], "kiwi.system.users": [[23, 1, 1, "", "Users"]], "kiwi.system.users.Users": [[23, 2, 1, "", "group_add"], [23, 2, 1, "", "group_exists"], [23, 2, 1, "", "setup_home_for_user"], [23, 2, 1, "", "user_add"], [23, 2, 1, "", "user_exists"], [23, 2, 1, "", "user_modify"]], "kiwi.tasks": [[24, 0, 0, "-", "base"], [24, 0, 0, "-", "result_bundle"], [24, 0, 0, "-", "result_list"], [24, 0, 0, "-", "system_build"], [24, 0, 0, "-", "system_create"], [24, 0, 0, "-", "system_prepare"], [24, 0, 0, "-", "system_update"]], "kiwi.tasks.base": [[24, 1, 1, "", "CliTask"]], "kiwi.tasks.base.CliTask": [[24, 2, 1, "", "attr_token"], [24, 2, 1, "", "load_xml_description"], [24, 2, 1, "", "quadruple_token"], [24, 2, 1, "", "run_checks"], [24, 2, 1, "", "tentuple_token"]], "kiwi.tasks.result_bundle": [[24, 1, 1, "", "ResultBundleTask"]], "kiwi.tasks.result_bundle.ResultBundleTask": [[24, 2, 1, "", "process"]], "kiwi.tasks.result_list": [[24, 1, 1, "", "ResultListTask"]], "kiwi.tasks.result_list.ResultListTask": [[24, 2, 1, "", "process"]], "kiwi.tasks.system_build": [[24, 1, 1, "", "SystemBuildTask"]], "kiwi.tasks.system_build.SystemBuildTask": [[24, 2, 1, "", "process"]], "kiwi.tasks.system_create": [[24, 1, 1, "", "SystemCreateTask"]], "kiwi.tasks.system_create.SystemCreateTask": [[24, 2, 1, "", "process"]], "kiwi.tasks.system_prepare": [[24, 1, 1, "", "SystemPrepareTask"]], "kiwi.tasks.system_prepare.SystemPrepareTask": [[24, 2, 1, "", "process"]], "kiwi.tasks.system_update": [[24, 1, 1, "", "SystemUpdateTask"]], "kiwi.tasks.system_update.SystemUpdateTask": [[24, 2, 1, "", "process"]], "kiwi.utils": [[25, 0, 0, "-", "block"], [25, 0, 0, "-", "checksum"], [25, 0, 0, "-", "compress"], [25, 0, 0, "-", "sync"], [25, 0, 0, "-", "sysconfig"]], "kiwi.utils.block": [[25, 1, 1, "", "BlockID"]], "kiwi.utils.block.BlockID": [[25, 2, 1, "", "get_blkid"], [25, 2, 1, "", "get_filesystem"], [25, 2, 1, "", "get_label"], [25, 2, 1, "", "get_partition_count"], [25, 2, 1, "", "get_uuid"]], "kiwi.utils.checksum": [[25, 1, 1, "", "Checksum"]], "kiwi.utils.checksum.Checksum": [[25, 2, 1, "", "matches"], [25, 2, 1, "", "md5"], [25, 2, 1, "", "sha256"]], "kiwi.utils.compress": [[25, 1, 1, "", "Compress"]], "kiwi.utils.compress.Compress": [[25, 2, 1, "", "get_format"], [25, 2, 1, "", "gzip"], [25, 2, 1, "", "uncompress"], [25, 2, 1, "", "xz"]], "kiwi.utils.sync": [[25, 1, 1, "", "DataSync"]], "kiwi.utils.sync.DataSync": [[25, 2, 1, "", "sync_data"], [25, 2, 1, "", "target_supports_extended_attributes"]], "kiwi.utils.sysconfig": [[25, 1, 1, "", "SysConfig"]], "kiwi.utils.sysconfig.SysConfig": [[25, 2, 1, "", "get"], [25, 2, 1, "", "write"]], "kiwi.volume_manager": [[26, 1, 1, "", "VolumeManager"], [26, 0, 0, "-", "base"], [26, 0, 0, "-", "btrfs"], [26, 0, 0, "-", "lvm"]], "kiwi.volume_manager.VolumeManager": [[26, 2, 1, "", "new"]], "kiwi.volume_manager.base": [[26, 1, 1, "", "VolumeManagerBase"]], "kiwi.volume_manager.base.VolumeManagerBase": [[26, 2, 1, "", "apply_attributes_on_volume"], [26, 2, 1, "", "create_verification_metadata"], [26, 2, 1, "", "create_verity_layer"], [26, 2, 1, "", "create_volume_paths_in_root_dir"], [26, 2, 1, "", "create_volumes"], [26, 3, 1, "", "custom_args"], [26, 3, 1, "", "custom_filesystem_args"], [26, 3, 1, "", "device"], [26, 3, 1, "", "device_map"], [26, 3, 1, "", "device_provider_root"], [26, 2, 1, "", "get_canonical_volume_list"], [26, 2, 1, "", "get_device"], [26, 2, 1, "", "get_fstab"], [26, 2, 1, "", "get_mountpoint"], [26, 2, 1, "", "get_root_volume_name"], [26, 2, 1, "", "get_volume_mbsize"], [26, 2, 1, "", "get_volumes"], [26, 2, 1, "", "is_loop"], [26, 2, 1, "", "mount"], [26, 3, 1, "", "mount_list"], [26, 2, 1, "", "mount_volumes"], [26, 3, 1, "", "mountpoint"], [26, 2, 1, "", "post_init"], [26, 3, 1, "", "root_dir"], [26, 2, 1, "", "set_property_readonly_root"], [26, 2, 1, "", "setup"], [26, 2, 1, "", "setup_mountpoint"], [26, 2, 1, "", "sync_data"], [26, 2, 1, "", "umount"], [26, 2, 1, "", "umount_volumes"], [26, 3, 1, "", "volume_group"], [26, 3, 1, "", "volume_map"], [26, 3, 1, "", "volumes"]], "kiwi.volume_manager.btrfs": [[26, 1, 1, "", "VolumeManagerBtrfs"]], "kiwi.volume_manager.btrfs.VolumeManagerBtrfs": [[26, 2, 1, "", "create_volumes"], [26, 2, 1, "", "get_fstab"], [26, 2, 1, "", "get_mountpoint"], [26, 2, 1, "", "get_root_volume_name"], [26, 2, 1, "", "get_volumes"], [26, 2, 1, "", "mount_volumes"], [26, 2, 1, "", "post_init"], [26, 2, 1, "", "set_property_readonly_root"], [26, 2, 1, "", "setup"], [26, 2, 1, "", "sync_data"], [26, 2, 1, "", "umount_volumes"]], "kiwi.volume_manager.lvm": [[26, 1, 1, "", "VolumeManagerLVM"]], "kiwi.volume_manager.lvm.VolumeManagerLVM": [[26, 2, 1, "", "create_volumes"], [26, 2, 1, "", "get_device"], [26, 2, 1, "", "get_fstab"], [26, 2, 1, "", "get_volumes"], [26, 2, 1, "", "mount_volumes"], [26, 2, 1, "", "post_init"], [26, 2, 1, "", "setup"], [26, 2, 1, "", "umount_volumes"]], "kiwi.xml_description": [[1, 1, 1, "", "XMLDescription"]], "kiwi.xml_description.XMLDescription": [[1, 2, 1, "", "get_extension_xml_data"], [1, 2, 1, "", "load"]], "kiwi.xml_state": [[1, 1, 1, "", "ContainerT"], [1, 1, 1, "", "FileT"], [1, 1, 1, "", "XMLState"], [1, 1, 1, "", "description_type"], [1, 1, 1, "", "package_type"], [1, 1, 1, "", "size_type"], [1, 1, 1, "", "volume_type"]], "kiwi.xml_state.ContainerT": [[1, 3, 1, "", "backend"], [1, 3, 1, "", "container_file"], [1, 3, 1, "", "fetch_command"], [1, 3, 1, "", "fetch_only"], [1, 3, 1, "", "load_command"], [1, 3, 1, "", "name"]], "kiwi.xml_state.FileT": [[1, 3, 1, "", "owner"], [1, 3, 1, "", "permissions"], [1, 3, 1, "", "target"]], "kiwi.xml_state.XMLState": [[1, 2, 1, "", "add_container_config_label"], [1, 2, 1, "", "add_repository"], [1, 2, 1, "", "btrfs_default_volume_requested"], [1, 2, 1, "", "collection_matches_host_architecture"], [1, 2, 1, "", "container_matches_host_architecture"], [1, 2, 1, "", "containers_matches_host_architecture"], [1, 2, 1, "", "copy_bootdelete_packages"], [1, 2, 1, "", "copy_bootincluded_archives"], [1, 2, 1, "", "copy_bootincluded_packages"], [1, 2, 1, "", "copy_bootloader_section"], [1, 2, 1, "", "copy_build_type_attributes"], [1, 2, 1, "", "copy_displayname"], [1, 2, 1, "", "copy_drivers_sections"], [1, 2, 1, "", "copy_machine_section"], [1, 2, 1, "", "copy_name"], [1, 2, 1, "", "copy_oemconfig_section"], [1, 2, 1, "", "copy_preferences_subsections"], [1, 2, 1, "", "copy_repository_sections"], [1, 2, 1, "", "copy_strip_sections"], [1, 2, 1, "", "copy_systemdisk_section"], [1, 2, 1, "", "delete_repository_sections"], [1, 2, 1, "", "delete_repository_sections_used_for_build"], [1, 2, 1, "", "get_archives_target_dirs"], [1, 2, 1, "", "get_bootloader_config_options"], [1, 2, 1, "", "get_bootloader_install_options"], [1, 2, 1, "", "get_bootloader_options"], [1, 2, 1, "", "get_bootloader_shim_options"], [1, 2, 1, "", "get_bootstrap_archives"], [1, 2, 1, "", "get_bootstrap_archives_target_dirs"], [1, 2, 1, "", "get_bootstrap_collection_type"], [1, 2, 1, "", "get_bootstrap_collections"], [1, 2, 1, "", "get_bootstrap_files"], [1, 2, 1, "", "get_bootstrap_ignore_packages"], [1, 2, 1, "", "get_bootstrap_package_name"], [1, 2, 1, "", "get_bootstrap_packages"], [1, 2, 1, "", "get_bootstrap_packages_sections"], [1, 2, 1, "", "get_bootstrap_products"], [1, 2, 1, "", "get_build_type_bootloader_bls"], [1, 2, 1, "", "get_build_type_bootloader_console"], [1, 2, 1, "", "get_build_type_bootloader_name"], [1, 2, 1, "", "get_build_type_bootloader_section"], [1, 2, 1, "", "get_build_type_bootloader_securelinux_section"], [1, 2, 1, "", "get_build_type_bootloader_serial_line_setup"], [1, 2, 1, "", "get_build_type_bootloader_settings_section"], [1, 2, 1, "", "get_build_type_bootloader_targettype"], [1, 2, 1, "", "get_build_type_bootloader_timeout"], [1, 2, 1, "", "get_build_type_bootloader_timeout_style"], [1, 2, 1, "", "get_build_type_bootloader_use_disk_password"], [1, 2, 1, "", "get_build_type_bundle_format"], [1, 2, 1, "", "get_build_type_containerconfig_section"], [1, 2, 1, "", "get_build_type_format_options"], [1, 2, 1, "", "get_build_type_machine_section"], [1, 2, 1, "", "get_build_type_name"], [1, 2, 1, "", "get_build_type_oemconfig_section"], [1, 2, 1, "", "get_build_type_partitions_section"], [1, 2, 1, "", "get_build_type_size"], [1, 2, 1, "", "get_build_type_spare_part_fs_attributes"], [1, 2, 1, "", "get_build_type_spare_part_size"], [1, 2, 1, "", "get_build_type_system_disk_section"], [1, 2, 1, "", "get_build_type_unpartitioned_bytes"], [1, 2, 1, "", "get_build_type_vagrant_config_section"], [1, 2, 1, "", "get_build_type_vmconfig_entries"], [1, 2, 1, "", "get_build_type_vmdisk_section"], [1, 2, 1, "", "get_build_type_vmdvd_section"], [1, 2, 1, "", "get_build_type_vmnic_entries"], [1, 2, 1, "", "get_collection_modules"], [1, 2, 1, "", "get_collection_type"], [1, 2, 1, "", "get_collections"], [1, 2, 1, "", "get_container_config"], [1, 2, 1, "", "get_containers"], [1, 2, 1, "", "get_containers_sections"], [1, 2, 1, "", "get_derived_from_image_uri"], [1, 2, 1, "", "get_description_section"], [1, 2, 1, "", "get_disk_start_sector"], [1, 2, 1, "", "get_distribution_name_from_boot_attribute"], [1, 2, 1, "", "get_drivers_list"], [1, 2, 1, "", "get_fs_create_option_list"], [1, 2, 1, "", "get_fs_mount_option_list"], [1, 2, 1, "", "get_host_key_certificates"], [1, 2, 1, "", "get_ignore_packages"], [1, 2, 1, "", "get_image_packages_sections"], [1, 2, 1, "", "get_image_version"], [1, 2, 1, "", "get_include_section_reference_file_names"], [1, 2, 1, "", "get_initrd_system"], [1, 2, 1, "", "get_installmedia_initrd_modules"], [1, 2, 1, "", "get_locale"], [1, 2, 1, "", "get_luks_credentials"], [1, 2, 1, "", "get_luks_format_options"], [1, 2, 1, "", "get_oemconfig_oem_multipath_scan"], [1, 2, 1, "", "get_oemconfig_oem_resize"], [1, 2, 1, "", "get_oemconfig_oem_systemsize"], [1, 2, 1, "", "get_oemconfig_swap_mbytes"], [1, 2, 1, "", "get_oemconfig_swap_name"], [1, 2, 1, "", "get_package_manager"], [1, 2, 1, "", "get_package_sections"], [1, 2, 1, "", "get_packages_sections"], [1, 2, 1, "", "get_partitions"], [1, 2, 1, "", "get_preferences_sections"], [1, 2, 1, "", "get_products"], [1, 2, 1, "", "get_release_version"], [1, 2, 1, "", "get_repositories_signing_keys"], [1, 2, 1, "", "get_repository_sections"], [1, 2, 1, "", "get_repository_sections_used_for_build"], [1, 2, 1, "", "get_repository_sections_used_in_image"], [1, 2, 1, "", "get_root_filesystem_uuid"], [1, 2, 1, "", "get_root_partition_uuid"], [1, 2, 1, "", "get_rpm_check_signatures"], [1, 2, 1, "", "get_rpm_excludedocs"], [1, 2, 1, "", "get_rpm_locale"], [1, 2, 1, "", "get_rpm_locale_filtering"], [1, 2, 1, "", "get_strip_files_to_delete"], [1, 2, 1, "", "get_strip_libraries_to_keep"], [1, 2, 1, "", "get_strip_list"], [1, 2, 1, "", "get_strip_tools_to_keep"], [1, 2, 1, "", "get_system_archives"], [1, 2, 1, "", "get_system_archives_target_dirs"], [1, 2, 1, "", "get_system_collection_type"], [1, 2, 1, "", "get_system_collections"], [1, 2, 1, "", "get_system_files"], [1, 2, 1, "", "get_system_ignore_packages"], [1, 2, 1, "", "get_system_packages"], [1, 2, 1, "", "get_system_products"], [1, 2, 1, "", "get_to_become_deleted_packages"], [1, 2, 1, "", "get_user_groups"], [1, 2, 1, "", "get_users"], [1, 2, 1, "", "get_users_sections"], [1, 2, 1, "", "get_vagrant_config_virtualbox_guest_additions"], [1, 2, 1, "", "get_volume_group_name"], [1, 2, 1, "", "get_volume_management"], [1, 2, 1, "", "get_volumes"], [1, 2, 1, "", "is_xen_guest"], [1, 2, 1, "", "is_xen_server"], [1, 2, 1, "", "package_matches_host_architecture"], [1, 2, 1, "", "preferences_matches_host_architecture"], [1, 2, 1, "", "profile_matches_host_architecture"], [1, 2, 1, "", "repository_matches_host_architecture"], [1, 2, 1, "", "resolve_this_path"], [1, 2, 1, "", "set_container_config_tag"], [1, 2, 1, "", "set_derived_from_image_uri"], [1, 2, 1, "", "set_repository"], [1, 2, 1, "", "set_root_filesystem_uuid"], [1, 2, 1, "", "set_root_partition_uuid"], [1, 2, 1, "", "volume_matches_host_architecture"]], "kiwi.xml_state.description_type": [[1, 3, 1, "", "author"], [1, 3, 1, "", "contact"], [1, 3, 1, "", "specification"]], "kiwi.xml_state.package_type": [[1, 3, 1, "", "package_section"], [1, 3, 1, "", "packages_section"]], "kiwi.xml_state.size_type": [[1, 3, 1, "", "additive"], [1, 3, 1, "", "mbytes"]], "kiwi.xml_state.volume_type": [[1, 3, 1, "", "attributes"], [1, 3, 1, "", "fullsize"], [1, 3, 1, "", "is_root_volume"], [1, 3, 1, "", "label"], [1, 3, 1, "", "mountpoint"], [1, 3, 1, "", "name"], [1, 3, 1, "", "parent"], [1, 3, 1, "", "realpath"], [1, 3, 1, "", "size"]]}, "objnames": {"0": ["py", "module", "Python module"], "1": ["py", "class", "Python class"], "2": ["py", "method", "Python method"], "3": ["py", "attribute", "Python attribute"], "4": ["py", "function", "Python function"], "5": ["py", "exception", "Python exception"]}, "objtypes": {"0": "py:module", "1": "py:class", "2": "py:method", "3": "py:attribute", "4": "py:function", "5": "py:exception"}, "terms": {"": [1, 4, 7, 18, 20, 21, 22, 23, 26, 28, 29, 30, 33, 36, 45, 46, 47, 49, 51, 52, 53, 54, 56, 57, 60, 61, 63, 67, 68, 72, 74, 77, 78, 79, 80, 82, 83, 84, 87, 92, 96, 98], "0": [1, 4, 6, 10, 12, 14, 15, 20, 23, 29, 32, 33, 34, 38, 47, 48, 49, 53, 55, 57, 58, 60, 68, 74, 75, 77, 78, 79, 80, 83, 85, 86, 87, 89, 94, 95, 96], "00": 93, "04": [54, 72], "08": 68, "0x0": 60, "0x1b8": 23, "0xfe": 23, "0xff": 60, "1": [0, 1, 4, 6, 10, 20, 23, 25, 26, 28, 29, 30, 31, 32, 33, 35, 45, 49, 51, 53, 54, 55, 57, 59, 60, 61, 62, 64, 65, 66, 68, 69, 72, 73, 74, 77, 78, 79, 80, 83, 84, 85, 86, 87, 89, 90, 91, 93, 94, 95, 96, 98], "10": [0, 34, 35, 38, 45, 54, 55, 57, 59, 60, 62, 64, 65, 66, 68, 69, 77, 80, 93], "100": [14, 30, 55, 72, 80, 82, 93], "1003746": 33, "100g": 80, "1024": 85, "10240": [86, 87], "10g": [86, 87], "10sec": [1, 93], "11": [54, 93], "119cwxvdxfuvyeinjh77unzrnahj": 67, "12": [34, 51], "1275903": 80, "1275904": 80, "128": [15, 60], "1296383": 80, "1296384": 80, "1316863": 80, "1316864": 80, "1337343": 80, "1337344": 80, "14dtqba5f1mgcvf": 67, "15": [28, 30, 31, 32, 33, 38, 48, 61, 67, 68, 69, 77, 78, 83, 84, 90, 91, 93, 94, 95], "15gb": 64, "16": [30, 54, 72], "168": [30, 93], "192": [30, 93], "19699": 51, "1g": 83, "1sec": 84, "2": [0, 1, 4, 6, 20, 22, 23, 25, 33, 35, 45, 54, 55, 57, 59, 60, 62, 64, 65, 66, 69, 74, 77, 80, 93, 96], "20": [33, 38, 60, 80], "200": 60, "2003": 34, "200m": 60, "2019": 54, "2021": [54, 68], "20211008": 68, "2048": [15, 30, 80], "2048000": 84, "20g": [30, 37, 72], "20mb": 60, "21": 29, "22": [29, 72], "23": [54, 60], "234": 60, "25519": 54, "26": 54, "28": 63, "2g": 83, "3": [1, 4, 20, 23, 28, 30, 31, 32, 33, 38, 54, 55, 60, 61, 63, 64, 68, 69, 72, 74, 77, 79, 80, 84, 90, 91, 93, 94, 95], "30": [29, 38, 46], "300": [80, 85], "30720": 85, "30g": 85, "32": 60, "32bit": 1, "32g": 72, "38400n8": 87, "3864575": 80, "3864576": 80, "39": 60, "3xzteojzch2qczjega5zsp9lxi": 67, "4": [1, 20, 23, 33, 51, 54, 60, 74, 77, 79, 80], "40": [1, 38], "4096": [30, 32, 33, 54, 69, 93], "42": [10, 33, 89], "45": 14, "47103": 80, "47104": 80, "480g": 46, "4g": [29, 83], "4k": 93, "4k9c7pjlg1adh8sf": 67, "5": [1, 20, 23, 28, 30, 32, 33, 38, 49, 54, 60, 64, 67, 68, 69, 78, 80, 93], "50": [38, 46, 54, 60], "500g": 46, "500m": 83, "500mb": 46, "512": [1, 30, 33, 60], "5mb": 93, "6": [1, 23, 80], "6143": 80, "6144": 80, "6287326": 80, "64": 33, "64_efi": 96, "64bit": [1, 47], "65535": 1, "661503": 80, "661504": 80, "7": [1, 2, 23, 46, 79, 80], "700m": 1, "73": 93, "75": 54, "8": [1, 23, 29, 32, 33, 47, 48, 49, 53, 60, 67, 68, 77, 78, 80, 83, 89], "80": 10, "8300": 80, "9": [28, 54, 80], "90": 46, "90my": 46, "99": [55, 60, 68], "9_": 60, "9p": [67, 72], "9pf": 67, "A": [1, 11, 21, 22, 23, 24, 25, 31, 32, 33, 38, 39, 41, 43, 46, 47, 48, 49, 50, 51, 52, 53, 54, 60, 61, 64, 65, 68, 77, 79, 80, 82, 85, 86, 87, 88, 89, 93, 94, 95], "And": [47, 62, 68], "As": [23, 29, 45, 46, 49, 51, 56, 57, 60, 61, 67, 68, 71, 77, 80, 90, 91, 93, 98], "At": [45, 46, 57, 60, 62, 64, 74], "Be": 92, "But": 30, "By": [1, 20, 21, 25, 30, 31, 38, 45, 46, 49, 51, 60, 61, 77, 80, 82, 93], "For": [4, 6, 7, 13, 20, 25, 29, 30, 31, 32, 33, 34, 36, 37, 41, 43, 45, 46, 47, 48, 51, 52, 54, 56, 57, 58, 60, 61, 63, 65, 67, 68, 72, 73, 74, 75, 77, 78, 79, 80, 82, 83, 85, 86, 87, 89, 91, 92, 93, 94, 95], "If": [1, 6, 12, 16, 19, 20, 21, 22, 23, 24, 25, 26, 30, 32, 34, 36, 37, 38, 39, 41, 43, 45, 46, 47, 49, 50, 51, 54, 57, 58, 60, 61, 62, 63, 65, 67, 68, 69, 71, 72, 77, 79, 80, 81, 82, 83, 84, 89, 93, 94, 96], "In": [1, 6, 11, 12, 13, 14, 16, 20, 21, 23, 26, 30, 31, 32, 34, 41, 42, 43, 46, 47, 48, 51, 52, 54, 57, 60, 61, 62, 63, 64, 65, 67, 69, 72, 73, 74, 75, 77, 79, 80, 81, 82, 83, 84, 88, 89, 90, 91, 92, 93, 94, 95, 96], "It": [1, 12, 21, 23, 28, 29, 30, 32, 33, 34, 38, 39, 41, 43, 45, 46, 48, 49, 51, 52, 53, 54, 55, 56, 58, 60, 61, 64, 65, 74, 75, 77, 78, 80, 87, 92, 93, 98], "NOT": 51, "No": 67, "Not": [6, 60, 93, 94, 95], "Of": 84, "On": [23, 30, 51, 54, 56, 60, 75, 81, 93, 94, 95, 96], "One": [60, 71, 83], "Or": [54, 69, 77], "Such": [60, 73, 88, 93], "That": [1, 23, 60, 68, 77, 96], "The": [1, 2, 4, 6, 9, 11, 12, 13, 14, 16, 18, 19, 20, 21, 22, 23, 24, 25, 26, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 41, 42, 43, 44, 46, 48, 49, 51, 52, 53, 55, 56, 58, 59, 60, 61, 63, 64, 65, 67, 68, 69, 70, 71, 72, 73, 75, 77, 78, 79, 80, 81, 82, 83, 84, 88, 89, 90, 91, 92, 93, 94, 95, 96, 98], "Their": 62, "Then": [28, 58], "There": [1, 6, 12, 14, 23, 26, 47, 51, 52, 59, 60, 63, 73, 74, 75, 77, 79, 80, 82, 84, 96], "These": [1, 22, 23, 33, 47, 51, 52, 54, 56, 58, 63, 64, 65, 77], "To": [29, 30, 31, 32, 33, 45, 46, 51, 54, 58, 60, 61, 63, 64, 67, 68, 71, 72, 74, 75, 76, 78, 79, 82, 85, 86, 87, 89, 93, 94, 96, 97], "With": [29, 31, 32, 46, 52, 58, 60, 62, 67, 71, 80, 90, 92, 93, 96], "_": [39, 41, 56, 61], "__init__": 54, "_cmdline": 6, "_config": 41, "_create_embedded_fat_efi_imag": 13, "_kernel_module_list_": 46, "_multibuild": [77, 78], "_non_": 23, "_per_test": 58, "_tools_my_module_script_needs_": 46, "aaaaaaaaaaaaaaaaaaaaaabbbbbbbbbbbbbbbbbb": 54, "aaaab3nzac1yc2eaaaadaqabaaabgqctiqdaygemkr7za7qc4ipxftgu": 67, "aabbccddeeff0011": 54, "aarch64": 71, "ab": 93, "abc": 6, "abil": [62, 91, 92], "abl": [15, 23, 51, 52, 60, 71, 74, 75, 85, 86, 87, 91, 92, 96, 97], "abort": [45, 51], "about": [1, 13, 21, 26, 36, 38, 41, 43, 45, 54, 56, 57, 59, 60, 61, 64, 65, 74, 79, 80, 81, 82, 90, 91, 93, 96, 98], "abov": [21, 30, 34, 38, 46, 48, 49, 51, 54, 57, 58, 59, 60, 61, 67, 71, 72, 77, 80, 82, 84, 85, 86, 87, 89, 92, 93, 94, 95], "absolut": [1, 49, 60], "abstract": [6, 45, 51, 54, 55, 57, 64, 65, 67, 68, 69, 70, 72, 74, 75, 77], "accept": [32, 49, 79], "access": [1, 20, 24, 29, 51, 53, 60, 62, 75, 77, 88, 91, 92, 93, 94, 95], "access_mod": 1, "accident": 45, "accommod": 60, "accomplish": 45, "accord": [1, 6, 16, 20, 23, 26, 30, 34, 44, 47, 56, 60, 82, 93], "accordingli": 93, "account": [1, 7, 16, 21, 34, 46, 47, 53, 60, 62, 64, 68], "accumulate_fil": 23, "accumulate_mbyte_file_s": 23, "accur": [14, 60], "achiev": [78, 89], "acknowledg": 30, "across": [61, 67], "act": [43, 47, 64, 78], "action": [1, 6, 30, 51, 60, 75, 95], "activ": [1, 16, 20, 23, 26, 30, 32, 46, 51, 54, 60, 61, 62, 64, 84, 86, 87, 90, 91, 93, 97], "activate_boot_partit": 20, "actual": [1, 4, 21, 22, 23, 49, 52, 61, 63, 68, 69, 80, 81, 83], "ad": [4, 13, 23, 30, 45, 51, 54, 57, 60, 67, 68, 77, 78, 81, 82, 83, 89, 92], "adapt": [23, 60, 77, 96], "add": [1, 4, 6, 13, 16, 18, 22, 23, 24, 25, 28, 29, 30, 31, 32, 33, 34, 36, 41, 43, 44, 45, 46, 47, 49, 51, 54, 55, 57, 60, 63, 65, 67, 68, 76, 77, 78, 79, 82, 85, 86, 87, 88, 89, 92, 97], "add_bundle_format": 23, "add_container_config_label": 1, "add_dracutmodul": [46, 95], "add_efi_loader_paramet": 13, "add_repo": 16, "add_repositori": [1, 18, 55], "addit": [1, 15, 16, 21, 22, 23, 28, 29, 30, 31, 32, 33, 34, 37, 38, 45, 46, 47, 48, 50, 51, 52, 57, 60, 61, 62, 64, 65, 68, 77, 78, 79, 80, 81, 82, 83, 89, 91, 92, 93], "addition": [45, 48, 53, 60, 83, 89], "additional_nam": 10, "addrepo": [28, 34, 63], "address": [6, 13, 21, 22, 33, 54, 63, 67, 68, 93, 95, 96], "adher": [50, 54], "adjust": [60, 77, 93], "adm": 97, "administr": [62, 94], "advanc": 89, "advis": [37, 48, 53, 74], "ae": 60, "aead": 60, "af_vsock": 29, "affect": [42, 60], "afford": 75, "after": [4, 6, 12, 14, 16, 26, 29, 30, 36, 42, 45, 46, 47, 51, 54, 60, 61, 62, 65, 78, 80, 81, 84, 94, 95, 98], "afterward": [51, 81], "again": [12, 45], "against": [1, 34, 51, 61, 65, 75], "agent": 85, "algorithm": 60, "alia": [1, 4, 20, 23, 36, 41, 43, 49, 60, 68, 98], "alias": 41, "all": [1, 6, 12, 16, 20, 23, 24, 26, 27, 28, 30, 31, 33, 34, 36, 38, 39, 41, 43, 45, 46, 47, 49, 50, 51, 52, 54, 58, 59, 60, 61, 65, 67, 68, 71, 73, 75, 77, 79, 80, 81, 83, 84, 86, 90, 91, 92, 93, 94, 95, 96, 98], "all_volum": 26, "allow": [1, 4, 11, 12, 16, 18, 23, 24, 30, 32, 34, 37, 38, 41, 43, 45, 46, 47, 49, 52, 54, 56, 57, 59, 60, 61, 62, 65, 67, 68, 75, 77, 79, 80, 81, 82, 83, 84, 85, 86, 87, 89, 91, 92, 93, 96], "allow_exist": 23, "allow_plymouth": 46, "almost": [1, 92], "alon": 51, "along": [1, 6, 30, 34, 46, 49, 60], "alongsid": [46, 54, 89], "alpha": 96, "alphanumer": 34, "alreadi": [1, 2, 16, 21, 25, 41, 43, 45, 46, 47, 51, 60, 65, 68, 82, 96], "also": [1, 4, 11, 12, 14, 21, 23, 24, 25, 26, 30, 31, 33, 36, 38, 39, 44, 45, 46, 47, 49, 51, 52, 54, 55, 58, 60, 61, 62, 63, 64, 67, 68, 71, 73, 77, 80, 81, 82, 83, 84, 87, 88, 89, 90, 91, 92, 93, 98], "altern": [13, 20, 38, 60, 64, 71, 79, 81, 82, 88, 89, 95, 98], "alternative_lookup_path": 1, "although": [38, 46, 77], "alwai": [1, 7, 20, 23, 30, 31, 60, 74, 77, 80, 82], "amazon": [1, 29, 33, 60, 61, 76], "among": [11, 65, 77, 80], "amount": [30, 60], "an": [1, 2, 4, 6, 9, 11, 12, 13, 14, 16, 20, 21, 23, 26, 27, 28, 31, 33, 34, 36, 38, 39, 40, 41, 42, 43, 45, 46, 47, 49, 50, 51, 52, 54, 55, 56, 57, 59, 60, 61, 62, 63, 64, 67, 68, 69, 71, 72, 73, 74, 75, 76, 77, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 91, 92, 93, 94, 95, 96, 98], "ani": [1, 4, 11, 13, 14, 15, 16, 20, 21, 22, 23, 26, 30, 31, 41, 42, 43, 45, 46, 47, 48, 49, 51, 52, 54, 57, 58, 59, 60, 61, 63, 64, 65, 67, 68, 69, 71, 73, 78, 80, 81, 82, 84, 88, 93, 94, 95], "annoi": 73, "annot": 60, "anoth": [1, 33, 48, 52, 60, 64, 68, 69, 79, 80, 93], "anymarkup": [1, 36, 52], "anymor": 80, "anyon": [53, 62], "anyth": [1, 23], "anywai": [54, 63], "aoe": [32, 93, 94, 95], "aoeinterfac": [94, 95], "aoeroot": 93, "apart": 63, "api": [1, 13, 54, 60, 62], "api_url": 1, "apparmor": 75, "appear": [33, 38, 49, 60, 77, 80, 82, 94, 95], "append": [1, 2, 9, 21, 23, 25, 30, 31, 39, 53, 60, 61, 81, 93, 94, 95], "append_fil": 2, "append_unpartitioned_spac": 9, "appidentif": 34, "appli": [1, 6, 23, 31, 32, 41, 43, 45, 46, 47, 48, 49, 51, 54, 55, 57, 60, 61, 65, 69, 75, 78, 80, 81, 83, 89, 93], "applianc": [4, 28, 29, 30, 31, 32, 33, 34, 38, 45, 46, 47, 48, 49, 51, 54, 60, 61, 64, 67, 69, 75, 76, 77, 79, 84, 93], "applic": [1, 33, 51, 54, 58, 60, 62, 64, 75, 79, 80, 84], "application_id": [34, 60], "apply_attributes_on_volum": 26, "appreci": 54, "approach": [46, 63, 82, 84, 93], "appropri": [9, 22, 23, 29, 31, 32, 33, 45, 54, 60, 61, 63, 77], "appx": [9, 34, 52, 60, 61], "appxmanifest": 34, "apschedul": 1, "apt": [41, 43, 45, 60, 67, 73, 79], "ar": [1, 6, 7, 9, 11, 15, 16, 21, 23, 25, 26, 28, 29, 30, 31, 32, 33, 34, 36, 38, 39, 41, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 57, 58, 59, 60, 61, 62, 63, 64, 65, 67, 68, 69, 70, 71, 73, 74, 75, 77, 79, 80, 81, 82, 83, 84, 89, 90, 91, 92, 93, 94, 95, 96, 98], "arbitrari": [21, 45, 54, 65], "arc_x86": 96, "arch": [1, 18, 21, 29, 33, 38, 47, 60, 61, 67, 68, 71, 77, 79, 83], "architectur": [1, 7, 16, 20, 23, 33, 34, 38, 39, 45, 47, 52, 54, 60, 61, 67, 70, 77, 79, 83], "archiv": [0, 1, 4, 10, 21, 23, 30, 33, 39, 45, 46, 52, 59, 61, 65, 77, 79, 89], "archive_tool": 1, "archivebuild": 9, "archivecpio": 2, "archivetar": 2, "archlinux": 62, "area": [1, 9, 46, 60, 74, 82], "aren": 72, "arg": [1, 16, 21, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 51], "argument": [1, 6, 7, 9, 10, 11, 12, 14, 16, 21, 23, 24, 26, 60], "arm": [60, 62, 71], "armi": 62, "around": [13, 54], "arrai": [1, 20, 93], "articl": [33, 68, 75, 84, 85, 86, 87, 88, 89, 90, 91, 92, 94, 95], "artifact": [23, 61], "artifici": 1, "ask": [1, 20, 60, 67, 84], "aspect": [68, 73], "assert": 58, "assign": [1, 23, 47, 53, 60, 80, 90, 91, 93], "associ": [1, 31, 33, 41, 51, 60, 61, 67], "assum": [1, 23, 56, 65, 72, 89, 91, 93, 94, 95], "assumpt": 31, "asterix": 51, "ata": [32, 93, 94, 95], "atftp": 93, "attach": [30, 51, 57, 69, 84], "attempt": [1, 41], "attent": 33, "attlist": 57, "attr": [41, 43, 54], "attr_token": 24, "attribut": [1, 4, 6, 11, 16, 20, 23, 24, 25, 28, 29, 30, 31, 32, 33, 36, 39, 41, 43, 46, 47, 48, 49, 51, 53, 54, 57, 60, 61, 64, 79, 80, 82, 83, 84, 88, 89], "attribute_list": 60, "attribute_nam": 1, "audienc": 62, "authent": 19, "authkei": 86, "author": [1, 10, 28, 34, 59, 60, 68, 79], "authorized_kei": 67, "auto": [1, 32, 54, 63], "auto_contain": 58, "auto_container_per_test": 58, "autodetect": 25, "autof": 81, "autogener": 1, "autom": [64, 65, 77], "automat": [1, 21, 30, 32, 34, 46, 51, 54, 60, 65, 77, 80, 89], "automount": 81, "autoyast": 97, "avail": [1, 4, 19, 20, 30, 33, 36, 38, 41, 46, 47, 49, 51, 52, 54, 55, 58, 60, 63, 65, 67, 69, 73, 77, 80, 84, 93, 94, 96], "avoid": [1, 20, 45, 46, 51, 54, 60, 81, 82, 96], "aw": [27, 61, 86], "azur": [33, 60, 61, 76], "azurectl": 85, "b": [23, 24, 54, 79, 80], "back": [1, 25], "backend": [1, 60, 95], "background": 79, "backtrac": 1, "backward": 54, "bar": 1, "bar_length": 1, "bar_profil": 77, "base": [1, 2, 8, 9, 10, 17, 18, 20, 22, 23, 25, 28, 30, 32, 34, 37, 38, 41, 43, 45, 46, 47, 51, 52, 54, 56, 60, 61, 62, 63, 64, 66, 67, 71, 77, 79, 80, 82, 88, 89, 93, 94, 95], "base_imag": 10, "baseinsertservic": 51, "basenam": [1, 4, 24, 38], "basename_of_integrity_keyfile_without_file_extens": 60, "baseproduct": 51, "baseremoveservic": 51, "baseservic": 51, "basesetrunlevel": 51, "basestrip": 51, "basestripandkeep": 51, "basestriplocal": 51, "basestriptransl": 51, "basestripunusedlib": 51, "basesystem": 98, "basesystemdcal": 51, "basesystemdserviceinstal": 51, "basesysvserviceinstal": 51, "baseupdatesysconfig": 51, "baseurl": [16, 60], "basevagrantsetup": [51, 89], "bash": [1, 10, 23, 28, 29, 43, 46, 51, 65, 77, 86, 93], "basic": [1, 18, 28, 30, 36, 46, 64], "bc": 96, "bc_efi": 96, "bear": 77, "becam": 23, "becaus": [1, 6, 21, 28, 30, 31, 34, 41, 46, 51, 52, 58, 60, 62, 67, 80, 81, 82, 84, 90, 92, 98], "becom": [1, 13, 23, 24, 60, 67, 81, 83, 88, 90, 92], "beef": 22, "been": [14, 15, 21, 30, 45, 51, 60, 65, 93, 94, 95, 98], "befor": [1, 12, 20, 23, 30, 34, 41, 42, 43, 45, 46, 47, 51, 54, 60, 61, 63, 77, 78, 87, 93, 95], "beforehand": [54, 60, 93], "begin": [36, 45, 51, 60, 65, 79], "behav": [25, 36], "behavior": [1, 21, 46, 47, 60, 64, 65], "behaviour": [1, 23, 93], "being": [23, 32, 47, 60], "bellow": 77, "belong": [1, 47, 48, 49, 50, 52, 54, 60], "below": [1, 25, 26, 29, 30, 31, 32, 33, 41, 43, 46, 51, 52, 56, 57, 60, 69, 71, 98], "berlin": 60, "besid": [45, 62], "best": [70, 74, 77, 98], "better": [23, 54, 60, 77], "between": [1, 6, 16, 23, 38, 41, 43, 49, 60, 67, 71, 74, 80], "beyond": [38, 55], "bgrt": 60, "big": [1, 46, 84], "bigger": 54, "billing_cod": 21, "bin": [10, 28, 29, 46, 47, 51, 58, 83, 86], "bin_volum": 83, "binari": [1, 13, 28, 29, 34, 38, 47, 60, 61], "binarynam": 1, "bind": [1, 23, 38, 51], "bind_loc": 23, "bind_mount": 1, "binutil": 71, "bio": [1, 9, 20, 46, 52, 60, 90, 91, 93], "bios_grub": 1, "bios_mod": 1, "bit": [1, 33, 51, 54, 60, 65, 72], "bl": [1, 7, 60], "blkid": [20, 25], "blob": 60, "block": [1, 12, 20, 26, 46, 60, 80, 93, 94, 95], "blockdev": [20, 60], "blockid": 25, "blocksiz": [20, 60, 93], "blocksize_byt": 20, "blscfg": 60, "bold": 1, "bool": [1, 2, 4, 6, 7, 8, 10, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 54], "boolean": [1, 14, 33, 48, 49, 60, 83], "boostrap": 79, "boot": [0, 1, 6, 7, 9, 11, 13, 20, 23, 26, 30, 31, 32, 33, 37, 38, 42, 45, 51, 52, 60, 61, 62, 65, 67, 68, 69, 70, 73, 74, 76, 80, 81, 82, 84, 85, 86, 87, 88, 89, 90, 91], "boot_clon": [20, 60, 80], "boot_devic": [6, 7], "boot_device_nod": 23, "boot_dir": 6, "boot_directory_nam": 60, "boot_image_task": 9, "boot_names_typ": 4, "boot_opt": [6, 60], "boot_part_id": 23, "boot_partition_s": 20, "boot_path": 6, "boot_server_ip": 96, "boot_them": 13, "boot_timeout": 60, "boot_timeout_styl": 60, "boot_uuid": 6, "bootabl": [1, 9, 52, 60, 84, 90, 91], "bootcmd": 86, "bootctl": [6, 60], "bootdelet": 1, "bootfilesystem": [60, 80], "bootimag": [4, 9], "bootimagebas": [4, 9], "bootimagedracut": 4, "bootimagekiwi": 4, "bootimg": 4, "bootinclud": [1, 4], "bootload": [0, 1, 11, 13, 32, 51, 52, 68, 75, 80, 84, 85, 86, 87, 88, 89, 91, 93], "bootloaderconfigbas": 6, "bootloaderconfiggrub2": 6, "bootloaderinstal": 7, "bootloaderinstallbas": 7, "bootloaderinstallgrub2": 7, "bootloaderinstallsystemdboot": 7, "bootloaderinstallzipl": 7, "bootloaderset": 1, "bootloaderspecbas": 6, "bootloadersystemdboot": 6, "bootloadertemplategrub2": 8, "bootloaderzipl": 6, "bootopt": 30, "bootparam": 46, "bootpartit": [20, 60, 80, 85, 88], "bootparts": [60, 85], "bootpath": 60, "bootstrap": [1, 14, 16, 23, 41, 43, 45, 47, 51, 60, 76], "bootstrap_packag": [1, 14, 60], "bootup": 46, "bootwait": 30, "both": [1, 13, 32, 38, 45, 47, 51, 60, 61], "bottom": [45, 47, 77], "bound": 54, "box": [1, 21, 22, 51, 60, 62, 67, 71, 73, 74, 77, 89], "boxbuild": [70, 75], "bracket": [41, 43], "brand": 51, "break": [23, 30, 47, 51, 54, 77], "bridg": [30, 33, 93, 94], "brief": 77, "broken": [1, 71, 80, 89, 96], "brows": 98, "browser": 63, "bsize": 93, "btrf": [1, 6, 9, 60, 61, 82, 83], "btrfs_default_volume_request": 1, "btrfs_quota_group": 60, "btrfs_root_is_readonly_snapshot": 60, "btrfs_root_is_snapshot": 60, "btrfs_root_is_subvolum": 60, "btrfs_set_default_volum": 60, "bug": 54, "build": [1, 4, 6, 9, 12, 14, 16, 20, 21, 22, 23, 24, 25, 35, 36, 37, 38, 39, 40, 42, 43, 46, 47, 48, 49, 51, 54, 55, 59, 60, 61, 63, 64, 65, 66, 70, 71, 74, 75, 76, 79, 80, 81, 82, 84, 85, 86, 87, 88, 89, 90, 91, 92, 94, 95], "build_constraint": 1, "build_flavor": [77, 78], "build_result": 61, "build_service_tutori": 77, "build_typ": [1, 38, 55], "buildah": 1, "buildbox": 72, "buildenv": 1, "builder": [0, 1, 49, 54, 60, 62, 63, 64, 69, 75, 77, 93], "buildservic": [1, 23, 41, 77], "buildsystem": [1, 23, 28], "built": [1, 6, 30, 54, 58, 67, 68, 69, 77, 82, 84, 85, 86, 87, 89, 90, 91, 92, 93, 94, 95], "builtin": 46, "bumpvers": 54, "bundl": [1, 23, 24, 35, 72], "bundle_format": [1, 39, 61], "bundle_id": 39, "bundler": [24, 61], "busi": [1, 98], "buslog": 33, "by6jar3ajfkvrpshrzrqj6cwyu3bfmolupcpqok2xfyou2lepazdejgpsjq": 67, "bypass": [1, 46], "byte": [1, 20, 21, 23, 37, 60, 80, 82], "bytes": 1, "c": [1, 24, 29, 69, 92, 96], "c8": 93, "ca": [47, 60, 86], "cach": [1, 16, 23, 38, 41, 43], "calcul": [1, 12, 23, 30, 60, 82, 84], "calculate_id": 23, "call": [1, 4, 6, 14, 16, 17, 18, 20, 23, 26, 28, 31, 33, 38, 45, 46, 49, 50, 51, 52, 54, 56, 57, 59, 60, 61, 62, 64, 65, 67, 68, 74, 78, 81, 84, 89, 91, 92, 93, 96], "call_config_host_overlay_script": 23, "call_config_overlay_script": 23, "call_config_script": 23, "call_disk_script": 23, "call_edit_boot_config_script": 23, "call_edit_boot_install_script": 23, "call_image_script": 23, "call_post_bootstrap_script": 23, "call_pre_disk_script": 23, "callabl": 1, "caller": [1, 4, 13, 16, 22, 68], "can": [1, 6, 7, 12, 13, 21, 22, 23, 24, 25, 26, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 67, 68, 69, 71, 72, 73, 74, 75, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 98], "candid": 70, "cannot": [1, 32, 45, 47, 49, 51, 60, 61, 68, 77, 82, 89, 93], "canonical_volume_typ": 26, "capabi": 60, "capabl": [1, 13, 20, 30, 47, 60, 67, 71, 80], "capit": 54, "card": [59, 62], "care": [6, 11, 14, 21, 67, 80, 81], "carri": [22, 82, 89], "case": [1, 4, 6, 11, 12, 14, 21, 23, 25, 26, 30, 31, 32, 41, 43, 46, 47, 49, 51, 52, 54, 55, 58, 59, 60, 61, 63, 64, 67, 68, 69, 73, 81, 82, 83, 84, 88, 89, 93, 94, 95], "cat": 31, "categori": [1, 52], "caus": [1, 6, 41, 47, 60, 69, 74, 75, 80], "caution": [41, 47], "cc": 47, "cd": [22, 32, 45, 47, 60, 61, 65, 90, 91, 92, 93, 95, 97], "cdl": 60, "cdrom": [30, 32, 84], "cdroot": [23, 45, 65], "cento": [18, 47, 60, 62], "cert": [60, 86], "certain": [23, 31, 47, 60, 64, 75, 80, 82, 89], "certif": [34, 47, 60], "cfg": [6, 30, 86, 92, 93, 94, 95, 96], "chain": [45, 52, 60, 74], "chanc": 60, "chang": [1, 12, 21, 23, 25, 26, 34, 45, 46, 51, 54, 60, 61, 67, 75, 77, 79, 81, 86, 87, 93, 96], "changelog": [1, 23], "channel": [1, 54], "chapter": [51, 60, 69, 75, 83], "charact": [6, 16, 23, 34, 38, 54, 60], "characterist": 81, "chardev": 29, "chattr": 1, "check": [1, 4, 6, 7, 11, 19, 20, 21, 23, 24, 25, 26, 28, 30, 32, 33, 34, 46, 47, 49, 51, 54, 63, 68, 72, 74, 80, 81, 83, 90, 91, 92, 93], "check_appx_naming_conventions_valid": 1, "check_boot_description_exist": 1, "check_build_environ": 23, "check_consistent_kernel_in_boot_and_system_imag": 1, "check_container_tool_chain_instal": 1, "check_dracut_module_for_disk_oem_in_package_list": 1, "check_dracut_module_for_disk_overlay_in_package_list": 1, "check_dracut_module_for_live_iso_in_package_list": 1, "check_dracut_module_for_oem_install_in_package_list": 1, "check_dracut_module_versions_compatible_to_kiwi": 1, "check_efi_fat_image_has_correct_s": 1, "check_efi_mode_for_disk_overlay_correctly_setup": 1, "check_for_root_permiss": 1, "check_image_include_repos_publicly_resolv": 1, "check_image_type_uniqu": 1, "check_image_version_provid": 1, "check_include_references_unresolv": 1, "check_initrd_selection_requir": 1, "check_luksformat_options_valid": 1, "check_mediacheck_instal": 1, "check_partuuid_persistency_type_used_with_mbr": 1, "check_repositories_configur": 1, "check_swap_name_used_with_lvm": 1, "check_target_directory_not_in_shared_cach": 1, "check_volume_label_used_with_lvm": 1, "check_volume_setup_defines_multiple_fullsize_volum": 1, "check_volume_setup_defines_reserved_label": 1, "check_volume_setup_has_no_root_definit": 1, "check_xen_uniquely_setup_as_server_or_guest": 1, "checkbox": 77, "checker": [1, 60], "checkiso": 8, "checkisomd5": 32, "checkmedia": [1, 32], "checkout": [54, 69, 77], "checksum": [1, 9, 13, 30, 32, 39], "checksum_filenam": 25, "child": [21, 28, 30, 33, 47, 48, 49, 53, 60, 77, 83], "children": [47, 51], "chip": 62, "chkstat": 23, "chmod": 60, "choic": [1, 60, 68, 77, 92], "choos": [32, 33, 54, 55, 77], "chosen": 77, "chown": 60, "chroot": [1, 4, 14, 17, 23, 24, 43, 45, 47, 51, 60, 79, 81], "ci": [54, 79], "cid": 29, "cipher": 60, "circumst": 60, "circumv": [60, 76], "clang": 47, "class": [1, 2, 4, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 54, 55, 56], "class_vers": 23, "classic": 62, "classifi": [1, 59, 94, 95], "classmethod": 54, "clean": [14, 23, 54, 73], "clean_leftov": 14, "clean_package_manager_leftov": 23, "cleanup": [4, 14, 16, 23, 98], "cleanup_fil": 23, "cleanup_request": 14, "cleanup_unused_repo": 16, "clear": [7, 23, 41, 43, 51, 53, 54, 73], "clear_cach": 23, "cleartext": 60, "cli": [63, 86], "click": [54, 63, 77], "client": [30, 62, 67, 79, 94, 95, 96], "clitask": [24, 56], "clone": [1, 20, 38, 60, 63, 64, 68, 69, 76, 82], "clonedevic": 20, "close": [51, 69], "cloud": [1, 33, 38, 60, 61, 62, 85, 86, 87], "cloud_config_modul": 86, "cloud_dir": 86, "cloud_final_modul": 86, "cloud_init_modul": 86, "cmd": 28, "cmdline": [6, 95], "code": [1, 7, 14, 21, 23, 37, 46, 47, 51, 56, 57, 60, 68, 80, 87, 92, 93], "collabor": 54, "collect": [1, 14, 18, 23, 31, 38, 45, 47, 51, 52, 54, 59, 60, 62, 63, 64, 65, 76, 89, 93], "collection_matches_host_architectur": 1, "collection_modul": 14, "collection_request": 14, "colon": [1, 60], "color": [1, 6, 24, 38], "colorformatt": 1, "colormessag": 1, "column": [54, 60], "com": [21, 29, 33, 34, 38, 54, 56, 57, 63, 68, 69, 79], "combin": [1, 24, 26, 30, 31, 32, 38, 41, 43, 46, 60, 89, 93, 95], "come": [58, 62, 68, 71, 79], "comma": [24, 30, 33, 48, 51, 53, 60, 83], "command": [2, 14, 24, 28, 30, 31, 33, 34, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 48, 50, 54, 56, 57, 60, 61, 62, 63, 68, 69, 72, 78, 82, 89, 90, 91, 94, 95, 96], "command_arg": 56, "command_env": [14, 16], "command_usag": 1, "commandcallt": [1, 14], "commandcap": 1, "commanditer": 1, "commandlin": [1, 6, 24, 29, 51, 60, 61, 93], "commandprocess": 1, "commandt": 1, "comment": [10, 50, 78], "commit": 54, "common": [24, 28, 34, 46, 51, 60, 75, 93], "commun": [62, 63, 74], "compar": [25, 30, 47, 60, 67, 73, 94, 95], "comparis": 23, "comparison": 2, "compat": [1, 16, 26, 31, 32, 49, 51, 54, 60, 73, 74, 94, 95], "compil": [47, 74], "complain": 60, "complet": [29, 32, 34, 45, 46, 47, 51, 54, 60, 64, 65, 84], "complex": [33, 54, 75, 80], "compli": [85, 86, 87], "compliant": [1, 52, 60, 68], "compon": [1, 9, 16, 31, 32, 33, 34, 38, 41, 43, 45, 49, 51, 52, 60, 61, 62, 67, 83], "compos": 65, "compress": [1, 2, 4, 9, 10, 21, 23, 24, 32, 33, 39, 45, 46, 51, 54, 57, 60, 77, 93], "compress_arch": 10, "compressed_filenam": 25, "compression_postfix": [45, 65], "compressor": 1, "compromis": 47, "comput": [1, 21, 29, 30, 33, 60, 61, 64, 76, 90, 92], "concaten": [39, 61], "concept": [1, 12, 26, 46, 56, 60, 64, 65, 75, 80], "concern": [31, 32, 63], "condit": [1, 58, 60, 82], "conditionfirstboot": [23, 51], "conditit": 20, "conf": [6, 46, 51, 60, 74, 93, 95, 96], "conf_fil": 4, "config": [0, 1, 4, 7, 13, 16, 20, 22, 23, 24, 28, 29, 30, 31, 32, 33, 34, 38, 43, 45, 47, 50, 54, 55, 57, 58, 60, 62, 63, 64, 65, 68, 75, 77, 78, 80, 83, 89, 93, 95, 96, 97], "config_fil": [4, 23], "configfil": 38, "configopt": 60, "configpars": 16, "configur": [1, 4, 6, 8, 11, 12, 14, 15, 16, 17, 20, 21, 22, 23, 24, 26, 28, 30, 32, 34, 36, 38, 41, 43, 45, 46, 47, 48, 49, 54, 58, 59, 60, 61, 62, 64, 65, 68, 74, 75, 82, 84, 86, 87, 89, 91, 92, 94, 95], "configuraton": 8, "confirm": 46, "conflict": [1, 20, 60, 70, 77, 80, 82, 87], "conftest": 58, "confus": 96, "conjunct": [54, 58], "connect": [22, 29, 30, 33, 41, 43, 47, 51, 58, 60, 67, 93, 94], "consequ": [60, 68, 77, 80], "consid": [1, 14, 23, 28, 47, 51, 54, 60, 67, 70, 80, 82, 83, 93], "consider": 30, "consist": [1, 9, 11, 12, 26, 31, 34, 38, 45, 51, 52, 54, 60, 61, 89, 93], "consol": [1, 11, 23, 29, 46, 60, 72, 85, 86, 87], "constant": [1, 54], "constraint": [1, 60, 64, 70, 71, 83, 85, 86, 87], "construct": [1, 6, 12, 60, 82], "constructor": [1, 20], "consult": [60, 78], "consum": [34, 54, 60, 68, 98], "contact": [1, 59, 60, 68, 69, 79], "contain": [0, 1, 4, 6, 7, 18, 20, 21, 23, 24, 25, 27, 30, 31, 36, 37, 38, 39, 40, 41, 43, 45, 46, 47, 48, 49, 50, 51, 52, 55, 58, 59, 61, 63, 64, 65, 66, 69, 73, 74, 75, 77, 80, 82, 89, 93], "container_fil": 1, "container_imag": 58, "container_matches_host_architectur": 1, "container_nam": 10, "container_per_test": 58, "container_runtim": 58, "container_tag": 10, "container_to_vm_lay": 68, "containerbuild": 9, "containerconfig": [1, 28, 34], "containerd": 28, "containerimag": 10, "containerimagebas": 10, "containerimageoci": 10, "containers_matches_host_architectur": 1, "containersetup": 11, "containersetupbas": 11, "containersetupdock": 11, "containersetupoci": 11, "containert": 1, "containig": 61, "content": [34, 38, 41, 43, 44, 51, 56, 60, 61, 63, 64, 68, 77, 78, 81, 82, 84, 93, 95, 96, 98], "context": [1, 23, 26, 34, 47], "continu": [6, 23, 30, 46, 51, 72], "contrari": 93, "contrast": [77, 89], "contribut": [62, 63], "control": [1, 4, 6, 11, 22, 39, 46, 47, 51, 60, 67, 73, 81, 89, 93], "conv": 30, "conv60_apirefer": 33, "conveni": 77, "convent": [1, 60, 61, 80], "convers": [1, 21, 36], "convert": [1, 21, 33, 36, 45, 57], "convet": 21, "cool": 57, "cop": 20, "cope": 60, "copi": [1, 4, 12, 23, 28, 30, 45, 46, 58, 60, 61, 63, 64, 65, 72, 77, 82, 83, 90, 91, 92, 93, 94, 95, 97], "copy_bootdelete_packag": 1, "copy_bootincluded_arch": 1, "copy_bootincluded_packag": 1, "copy_bootloader_sect": 1, "copy_build_type_attribut": 1, "copy_displaynam": 1, "copy_drivers_sect": 1, "copy_kernel": 23, "copy_machine_sect": 1, "copy_nam": 1, "copy_oemconfig_sect": 1, "copy_on_writ": 83, "copy_preferences_subsect": 1, "copy_repository_sect": 1, "copy_strip_sect": 1, "copy_systemdisk_sect": 1, "copy_xen_hypervisor": 23, "core": [1, 23, 52, 54, 71, 73, 96], "corespersocket": 33, "coreutil": 47, "corner": 54, "correct": [1, 6, 22, 30, 33, 46, 49, 57, 74, 84, 89, 93], "correctli": [6, 15, 42, 51, 60, 96], "correspond": [1, 6, 30, 60], "corrupt": 1, "could": [1, 11, 12, 20, 23, 36, 49, 60, 75, 77, 79, 93, 94], "couldn": 25, "count": [12, 33], "countdown": 60, "coupl": 60, "cover": [0, 6, 24, 28, 29, 30, 32, 33, 60, 62, 75, 93], "coverag": 54, "cow": [32, 46, 60], "cowf": [32, 46], "cowfil": [32, 46], "cp": [93, 94, 95, 97], "cpio": [9, 29, 46, 60, 77], "cpu": [22, 29, 33, 61, 72], "cpu_setup": 22, "cpuid": 33, "cracklib": 60, "crasgmgkim8apnk8rff": 67, "creat": [1, 2, 4, 6, 9, 10, 11, 12, 13, 15, 16, 19, 20, 21, 22, 23, 24, 25, 26, 28, 29, 30, 31, 32, 35, 38, 39, 40, 41, 43, 46, 47, 49, 51, 52, 55, 56, 57, 58, 59, 60, 61, 62, 64, 65, 67, 69, 71, 72, 73, 75, 77, 80, 81, 82, 83, 84, 86, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98], "create_boot_loader_config": 6, "create_boot_partit": 20, "create_box_img": 21, "create_crypto_luk": 20, "create_crypttab": 20, "create_custom_partit": 20, "create_degraded_raid": 20, "create_disk": 9, "create_disk_format": 9, "create_efi_csm_partit": 20, "create_efi_partit": 20, "create_efi_path": 6, "create_from_file_list": 2, "create_fstab": 23, "create_gnu_gzip_compress": 2, "create_hybrid_mbr": 20, "create_image_format": 21, "create_init_link_from_linuxrc": 23, "create_initrd": 4, "create_install_iso": 9, "create_install_media": 9, "create_install_pxe_arch": 9, "create_iso": 13, "create_loader_imag": 6, "create_match_method": 1, "create_mbr": 20, "create_on_devic": [12, 55], "create_on_fil": 12, "create_opt": 12, "create_prep_partit": 20, "create_raid_config": 20, "create_random_keyfil": 20, "create_recovery_arch": 23, "create_repository_solv": 19, "create_root_lvm_partit": 20, "create_root_partit": 20, "create_root_raid_partit": 20, "create_root_readonly_partit": 20, "create_spare_partit": 20, "create_swap_partit": 20, "create_verification_metadata": [12, 26], "create_verity_lay": [12, 26], "create_volum": 26, "create_volume_paths_in_root_dir": 26, "create_xz_compress": 2, "created_bi": [10, 34], "createimportspecparam": 33, "creation": [1, 2, 4, 6, 12, 13, 19, 20, 21, 23, 24, 25, 26, 32, 38, 45, 46, 51, 52, 54, 60, 62, 64, 65, 74, 76, 82], "creator": 60, "credenti": [1, 16, 20, 23, 41, 43, 60, 88], "credentials_fil": 16, "credentials_file_nam": 23, "criteria": [34, 62, 67], "critic": [38, 81, 88], "crl": 60, "cross": [38, 67, 71], "crt": 60, "crucial": 49, "cryptsetup": [1, 20, 60, 88], "crypttab": [20, 60], "csm": 60, "curl": [30, 93], "curl_opt": 30, "curli": [41, 43], "current": [1, 6, 7, 10, 15, 20, 21, 23, 26, 33, 47, 49, 54, 58, 60, 68, 77, 89, 94], "curv": 54, "custom": [1, 2, 4, 6, 7, 9, 10, 11, 12, 13, 14, 16, 20, 21, 23, 25, 26, 28, 29, 31, 45, 47, 49, 51, 54, 56, 60, 61, 62, 63, 64, 65, 76, 77, 81, 86], "custom_arg": [6, 7, 9, 10, 11, 12, 13, 14, 16, 21, 26], "custom_env": 1, "custom_filesystem_arg": 26, "custom_script": 60, "custom_set": [21, 22], "customiz": [60, 61], "customization_script": 16, "customizaton": 20, "cut": 29, "cv": 61, "d": [23, 24, 29, 30, 46, 51, 95], "daemon": [51, 67, 89], "dasd": [20, 60], "data": [1, 2, 4, 6, 9, 12, 13, 14, 16, 20, 21, 23, 25, 26, 29, 30, 32, 34, 38, 41, 43, 45, 46, 51, 57, 59, 60, 61, 62, 64, 65, 67, 68, 75, 80, 82, 88, 90, 91, 92, 93, 96], "data_blks": 60, "data_block": 60, "databas": [1, 14, 16, 41, 42, 43, 47, 61, 63, 75], "database_consist": 14, "datasource_list": 86, "datasync": 25, "date": [19, 54, 63, 93], "datefmt": 1, "dbu": [51, 79], "dd": [30, 90], "de": 41, "de_d": 60, "deactiv": [1, 11, 51, 60, 93], "deactivate_bootloader_setup": 11, "deactivate_root_filesystem_check": 11, "deactivate_systemd_servic": 11, "dead": 22, "deb": [41, 43, 49], "debconf": 79, "debian": [1, 41, 43, 60, 62, 76], "debug": [1, 24, 32, 38, 58, 60, 61, 72], "debugfilt": 1, "decentr": 62, "decid": [1, 20, 96], "decis": 77, "declar": [46, 48, 77], "declin": 67, "decod": 1, "decompress": [25, 77], "decor": 54, "decrypt": 60, "dedent": 22, "dedic": [31, 41, 43], "def": [54, 56, 58], "defacto": 68, "default": [6, 7, 12, 15, 16, 20, 21, 22, 23, 25, 26, 28, 29, 30, 31, 32, 33, 36, 38, 45, 46, 48, 49, 50, 51, 53, 54, 58, 60, 61, 62, 67, 68, 74, 77, 78, 80, 82, 83, 86, 89, 93, 94, 95, 96], "default_boot": 60, "default_us": 86, "defin": [1, 9, 10, 21, 28, 33, 41, 43, 45, 46, 47, 48, 49, 58, 59, 60, 61, 64, 72, 77, 82, 83, 89], "definit": [1, 4, 14, 23, 46, 55, 56, 60, 61, 83, 84, 85, 86, 87, 88, 98], "degrad": [20, 60], "delai": [30, 60], "delet": [1, 14, 16, 23, 24, 41, 43, 44, 45, 47, 51, 60, 68, 81, 92], "delete_all_repo": 16, "delete_packag": 23, "delete_repo": 16, "delete_repo_cach": 16, "delete_repository_sect": 1, "delete_repository_sections_used_for_build": 1, "delimit": [41, 43], "deliv": [34, 41, 90, 92], "delta": [1, 51], "delta_root": [14, 23, 51, 60], "demand": [36, 57, 60], "demo": [60, 61], "demonstr": [32, 55, 68], "depend": [1, 6, 14, 18, 19, 20, 21, 22, 23, 30, 32, 33, 36, 38, 41, 43, 45, 46, 47, 51, 52, 57, 60, 61, 63, 65, 67, 71, 72, 73, 74, 75, 77, 80, 81, 83, 93, 96, 98], "deploi": [30, 32, 46, 60, 62, 64, 65, 76, 81, 82, 93, 96], "deploy": [4, 31, 32, 38, 46, 51, 60, 61, 65, 80, 84, 91, 92], "derefer": 1, "deriv": [1, 41, 43], "derived_from": [1, 41, 43, 60], "descend": [59, 60], "describ": [18, 30, 31, 32, 33, 41, 45, 47, 51, 54, 55, 57, 59, 60, 63, 67, 69, 70, 72, 76, 77, 94, 96], "descript": [1, 4, 6, 22, 23, 24, 28, 29, 30, 31, 32, 33, 34, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 57, 61, 62, 64, 67, 68, 69, 72, 76, 77, 78, 79, 81, 82, 83, 93, 97, 98], "description_directori": 24, "description_typ": 1, "deserv": 33, "design": [30, 33, 36, 52, 60, 68, 73, 77, 82], "desir": [1, 23, 26, 28, 30, 34, 51, 60, 63, 69, 71], "despit": 82, "dest": 93, "dest_dir": 2, "destroi": [20, 80, 90, 91, 92], "detail": [1, 7, 13, 14, 23, 25, 29, 30, 31, 32, 33, 34, 36, 38, 41, 43, 45, 46, 47, 48, 51, 52, 56, 60, 61, 64, 65, 67, 68, 74, 78, 80, 82, 83, 89, 93, 94, 95], "detect": [1, 23, 25, 30, 32, 46, 60], "determin": [1, 23, 30, 33, 60], "dev": [11, 20, 46, 72, 84, 90, 91, 93, 94, 95], "devel": 54, "develop": [21, 31, 33, 56, 80, 89], "devic": [1, 6, 7, 11, 12, 15, 20, 23, 25, 26, 30, 32, 33, 46, 47, 52, 55, 60, 62, 67, 75, 80, 84, 90, 91, 92, 93, 94, 95], "device1": 93, "device2": 93, "device_map": 26, "device_nod": [12, 26], "device_provid": [7, 12, 23], "device_provider_root": 26, "devicepersist": [1, 30, 60, 85, 86], "deviceprovid": [7, 12, 15, 20, 23, 26], "dhcp": [79, 89, 93], "dialog": [46, 60], "dict": [1, 4, 6, 7, 9, 10, 11, 12, 13, 14, 16, 18, 20, 21, 23, 24, 26, 60], "dictionari": [1, 4, 6, 7, 12, 20, 21, 23, 24, 26, 60], "dictonari": 4, "did": [1, 60], "dif": 61, "differ": [1, 6, 14, 15, 21, 23, 25, 26, 30, 31, 32, 33, 36, 38, 45, 47, 48, 49, 51, 54, 57, 58, 60, 61, 63, 67, 68, 71, 73, 76, 80, 82, 85, 86, 87, 88, 89, 90, 91, 92], "differenti": 60, "difficult": [45, 58], "digit": [34, 60], "dir": [1, 4, 12, 20, 23, 28, 29, 30, 31, 32, 33, 34, 37, 38, 39, 40, 41, 42, 46, 49, 60, 61, 67, 68, 69, 72, 78, 93], "dir_path": 60, "dir_stack": 23, "direct": [1, 28, 49, 60, 96], "directli": [28, 45, 47, 51, 54, 60, 65, 68, 91, 92], "directori": [1, 2, 4, 6, 7, 9, 10, 11, 12, 14, 16, 20, 21, 23, 24, 25, 26, 28, 30, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 49, 51, 53, 54, 55, 56, 60, 62, 64, 65, 67, 68, 77, 89, 93, 96, 97, 98], "disabl": [1, 14, 24, 30, 33, 51, 60, 75, 80, 82, 84, 96], "disable_root": 86, "disadvantag": 77, "disambigu": 60, "disast": 80, "discov": 30, "discuss": 54, "disk": [1, 6, 7, 13, 21, 22, 23, 27, 32, 37, 38, 45, 46, 51, 52, 60, 61, 64, 67, 69, 72, 74, 76, 80, 84, 85, 86, 87, 89, 90, 91, 92], "disk_control": 22, "disk_imag": 9, "disk_image_capac": 22, "disk_provid": 15, "diskbuild": 9, "diskformat": 21, "diskformatbas": 21, "diskformatgc": 21, "diskformatova": 21, "diskformatqcow2": 21, "diskformatvagrantbas": 21, "diskformatvagrantlibvirt": 21, "diskformatvagrantvirtualbox": 21, "diskformatvdi": 21, "diskformatvhd": 21, "diskformatvhdfix": 21, "diskformatvhdx": 21, "diskformatvmdk": 21, "diskful": 93, "diskless": 93, "diskmod": 33, "disknam": 23, "diskprovisioningtyp": 33, "disksetup": 20, "disktyp": 33, "displai": [6, 30, 38, 60, 96], "displaynam": [1, 6, 60], "dist": [16, 18, 28, 34, 54, 63], "distinguish": [48, 60], "distribut": [1, 20, 28, 33, 34, 41, 43, 45, 47, 49, 51, 52, 56, 57, 60, 62, 64, 65, 67, 69, 71, 73, 74, 77, 85, 86, 87, 88, 89, 92], "distributor": [6, 60, 62], "distro": [1, 77], "distro_appx_metadata_packag": 34, "disturl": 61, "div": 57, "divid": 80, "dm": 60, "dm_integr": 60, "dm_integrity_meta": 60, "dm_veriti": 60, "dm_verity_credenti": 60, "dmsquash": 60, "dn": [23, 96], "dnf": [14, 16, 45, 47, 49, 60, 63], "dnf4": 60, "dnf5": 60, "dnf_arg": [14, 16], "dnsmasq": 89, "do": [18, 20, 22, 23, 30, 45, 48, 49, 50, 54, 60, 62, 67, 69, 72, 75, 79, 90, 91, 96, 97], "doc": [1, 21, 34, 38, 54, 82], "docker": [1, 9, 28, 47, 52, 58, 60, 61, 68], "dockerfil": 28, "docopt": [1, 56], "docstr": 54, "doct": 14, "document": [0, 1, 21, 23, 27, 35, 41, 43, 45, 46, 48, 57, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 76, 77, 89], "doe": [1, 2, 6, 7, 11, 12, 14, 15, 23, 25, 26, 30, 32, 33, 34, 38, 41, 46, 51, 60, 62, 64, 65, 67, 68, 71, 74, 77, 79, 80, 84, 89, 92, 93], "doesn": [21, 26, 33, 34], "dom0": [1, 8], "domain": [1, 38, 96], "domu": 86, "domx": 1, "don": [1, 14, 54, 60, 67, 69, 77, 96], "done": [1, 4, 6, 7, 11, 15, 20, 23, 29, 30, 32, 34, 38, 51, 54, 56, 60, 61, 67, 80, 81, 82, 84, 93, 94, 95, 97, 98], "dosparttable_extended_layout": 60, "doubl": [30, 54, 63], "down": [1, 30], "download": [1, 19, 28, 30, 31, 34, 39, 41, 63, 68, 77, 79], "download_from_repositori": 19, "download_loc": 39, "download_url": 1, "downloadserv": 1, "downsid": 77, "dpkg": [47, 61, 67, 73], "dracut": [1, 30, 31, 32, 46, 51, 60, 84, 87, 91, 92, 95], "dracut_module_typ": 1, "dracut_output_nam": 4, "drive": [22, 31, 69, 84, 90, 92, 98], "driven": [54, 65], "driver": [1, 20, 22, 31, 33, 51, 60], "drop": [59, 72], "due": [14, 60, 75], "dumbkbd": 29, "dump": [1, 23, 30, 46, 60, 61, 80, 84, 90], "dump_reload_package_databas": 14, "duplic": 23, "durat": 1, "dure": [1, 14, 16, 23, 30, 36, 38, 40, 41, 42, 43, 45, 46, 47, 49, 51, 60, 65, 70, 72, 80, 82], "dvd": [22, 32, 45, 60, 61, 62, 65, 89, 90, 91, 92, 98], "dvd_drive": 98, "dynam": [1, 21], "e": [1, 2, 8, 11, 12, 21, 23, 24, 34, 36, 38, 45, 51, 54, 58, 60, 61, 65, 71, 75, 77, 78, 79, 80, 83, 93, 97], "e0": [93, 94, 95], "e1000": 33, "each": [1, 16, 23, 24, 30, 33, 34, 39, 41, 43, 46, 47, 48, 49, 50, 51, 52, 53, 55, 56, 60, 61, 64, 68, 77, 78, 80, 82, 83, 98], "earli": [1, 36, 41, 43, 60], "earlier": 51, "easi": [30, 54], "easier": 38, "eat": 26, "ec2": [1, 29, 33, 60, 61, 76], "ec2_mod": 1, "ec2uploadimg": 86, "ecc": 54, "echo": [29, 49, 51, 67, 95], "edit": [30, 54, 93, 94, 95, 97], "editbootconfig": [23, 60], "editbootinstal": [23, 60], "editor": 54, "ef00": 80, "ef02": 80, "effect": [1, 6, 12, 20, 21, 23, 26, 31, 41, 43, 46, 47, 51, 60, 73, 81, 83], "effort": [54, 60, 71], "efi": [1, 6, 7, 9, 13, 20, 47, 60, 68, 82, 91], "efi_csm": 82, "efi_devic": [6, 7], "efi_image_nam": 60, "efi_mod": 1, "efi_path": 1, "eficsm": 60, "efif": 60, "efifatimages": [1, 60], "efiparts": 60, "efipartt": 60, "eif": [29, 61], "either": [1, 6, 21, 23, 33, 37, 41, 43, 46, 47, 51, 53, 54, 56, 58, 60, 63, 64, 68, 69, 77, 80, 81, 93, 95], "ejabberd": 47, "el": 1, "element": [1, 18, 23, 24, 28, 29, 30, 31, 32, 33, 38, 39, 41, 43, 45, 48, 49, 51, 53, 57, 59, 61, 77, 78, 80, 82, 83, 89], "els": [1, 30, 54], "elsewher": 75, "eltorito": 1, "emac": 54, "email": [54, 77], "emb": [9, 13, 23], "embebbed_vagrantfil": [21, 89], "embed": [1, 6, 22, 23, 30, 47, 60, 62, 90, 92], "embed_integrity_metadata": 60, "embed_verity_metadata": 60, "embedded_vagrantfil": 89, "empir": [1, 23], "empti": [1, 4, 12, 14, 20, 21, 23, 57, 60, 79], "emu": 60, "emul": [22, 46, 60], "en": [30, 34, 77, 79, 93], "en_u": [60, 68], "enabl": [1, 14, 16, 29, 30, 33, 34, 46, 51, 54, 60, 77, 78, 96], "enclav": [1, 27, 61], "enclave_format": [1, 29], "enclos": [41, 43], "encod": [60, 68, 77, 78, 89], "encount": 46, "encourag": 77, "encrypt": [1, 53, 54, 60, 76], "end": [1, 12, 22, 25, 45, 46, 47, 49, 51, 60, 61, 65, 75, 77, 80, 82], "endian": 1, "enforc": 75, "engin": [21, 33, 60, 61, 76], "enough": [1, 11, 64, 72, 84], "ensur": [23, 47, 54, 58, 60, 89], "ensure_empty_tmpdir": [10, 60], "enter": [1, 43, 46, 54, 65, 88, 89], "enterpris": [51, 60, 77], "entir": [1, 2, 12, 34], "entiti": 57, "entri": [1, 6, 15, 23, 26, 30, 33, 41, 43, 51, 56, 60, 81, 82, 94, 95], "entry_command": 10, "entry_point": 56, "entry_subcommand": 10, "entrypoint": 28, "env": [28, 36], "environ": [1, 4, 6, 10, 14, 16, 23, 28, 29, 31, 36, 38, 45, 46, 47, 56, 58, 60, 61, 62, 65, 66, 73, 74, 75, 76, 84, 89, 93], "epoch": 61, "equal": [1, 6, 30], "equival": 28, "erof": 60, "erofscompress": 60, "error": [1, 14, 16, 36, 38, 41, 43, 45, 46, 51, 52, 54, 77], "error_avail": 1, "errorcod": 1, "errorfilt": 1, "esc": 91, "escap": [1, 38], "esp": [6, 60], "especi": [47, 73, 77], "essenti": 45, "establish": [29, 45, 60], "etc": [1, 6, 23, 30, 38, 45, 46, 50, 51, 55, 57, 60, 61, 74, 75, 80, 81, 82, 83, 86, 93, 95, 96, 97], "etc_volum": 83, "eth0": 89, "etherd": [93, 94, 95], "ethernet": [32, 93, 94, 95], "etre": 1, "europ": 60, "evalu": [1, 14, 21, 23, 41, 43, 60], "even": [6, 54, 60, 62, 63, 83, 93], "eventu": [39, 46, 60, 83], "everi": [1, 24, 30, 40, 46, 54, 60, 77, 92], "everyth": [1, 52, 54, 75], "eviron": 1, "ex": 34, "exact": [33, 52, 60, 82], "exactli": [67, 79], "examin": 1, "exampl": [1, 10, 22, 23, 25, 28, 30, 31, 32, 33, 34, 36, 37, 41, 43, 45, 46, 47, 48, 49, 51, 52, 54, 55, 57, 58, 60, 61, 67, 68, 69, 72, 73, 74, 77, 79, 80, 81, 82, 89, 93, 94, 95, 96, 98], "exc_image_base_nam": [47, 48, 49, 53, 60, 61, 84, 89, 90, 91, 94, 95], "exc_repo": 49, "exce": [1, 23], "exceed": 23, "except": [21, 23, 34, 41, 51, 54, 57, 60, 75, 93, 94, 95], "except_for": 1, "exclud": [1, 2, 10, 12, 23, 24, 25, 26, 47, 52, 78], "exclude_doc": 17, "exclude_fil": 1, "excludedoc": 1, "exclus": [14, 32], "execut": [1, 23, 28, 34, 45, 46, 51, 58, 60, 61, 65, 77, 78, 81], "exercis": 75, "exfat": 92, "exist": [1, 2, 6, 16, 19, 20, 21, 23, 26, 28, 30, 31, 34, 35, 41, 42, 43, 45, 46, 51, 52, 54, 55, 56, 57, 58, 60, 61, 62, 63, 64, 65, 66, 67, 68, 72, 81, 82, 89, 91, 92, 96, 97], "exit": [1, 28, 51, 72], "expand": [27, 38, 60, 61, 82, 84, 87], "expans": [30, 77], "expect": [1, 7, 14, 23, 31, 33, 34, 38, 45, 48, 49, 52, 56, 60, 61, 65, 67, 74, 89, 94, 95, 96], "expens": 58, "experi": [51, 77], "experiment": 67, "expert": 54, "expir": [54, 60], "explain": [28, 29, 30, 31, 32, 33, 34, 59, 60, 64, 75, 84, 93], "explan": [10, 28, 83], "explicit": [20, 26, 60], "explicitli": [1, 33, 46, 47, 51, 77], "export": [1, 23, 46, 47, 55, 92, 93, 94, 95], "export_modprobe_setup": 23, "export_package_chang": 23, "export_package_list": 23, "export_package_verif": 23, "exportnam": 95, "expos": [28, 67, 68], "expose_port": 10, "express": [1, 14, 23, 60], "ext": [60, 74], "ext2": [9, 60, 61, 82], "ext3": [9, 60, 61, 80, 82, 93], "ext4": [9, 32, 33, 48, 55, 60, 61, 80, 82, 84, 85, 86, 87, 88, 89], "extend": [1, 9, 15, 23, 25, 46, 51, 54, 56, 60, 66, 72, 82], "extended_layout": [15, 20], "extens": [1, 31, 36, 45, 60, 61, 63, 65, 84, 88, 89], "extern": [1, 28, 45, 68], "extra": [1, 6, 14, 20, 46, 51, 54, 60, 62, 79, 80, 82, 88, 91, 96], "extra_set": 22, "extract": [1, 2, 21, 22, 23, 45, 47, 51, 77, 79, 94], "f": [24, 29, 30, 51, 52, 67, 91], "f12": 91, "f3": 93, "f74y5fygiovxxy88wqrybuer1eayjhvk": 67, "f_ok": 1, "face": [54, 67], "facil": 1, "fact": [60, 61], "factor": 23, "factori": [4, 7, 9, 10, 11, 12, 13, 14, 15, 16, 19, 21, 26, 77, 80], "fail": [1, 14, 16, 19, 23, 34, 36, 46, 60, 67, 72, 77], "failsaf": [1, 6, 8, 60], "failsafe_boot_entry_request": 6, "failsafe_boot_opt": 60, "failur": [1, 47, 51], "fallback": 32, "fals": [1, 4, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 25, 26, 30, 32, 33, 41, 43, 49, 54, 60, 68, 80, 83, 84, 85, 86, 87, 88, 89], "famili": 60, "familiar": 65, "far": [15, 31, 93], "fashion": [65, 77], "fast": 67, "fat": [6, 12, 13, 60], "fat16": 60, "fat32": [32, 46, 60, 76, 92], "fatal": 46, "fb": 34, "fba": 60, "fdasd": 15, "fdisk": [15, 47], "featur": [2, 30, 32, 33, 34, 47, 51, 52, 60, 63, 77, 78, 80, 81, 82, 91, 92], "fedora": [14, 18, 47, 60, 62, 63], "fedoraproject": 29, "fedpkg": 54, "feedback": 67, "feel": 60, "fetch": [23, 30, 32, 49, 60, 67, 74, 93], "fetch_command": 1, "fetch_onli": [1, 60], "few": [68, 72], "ffffffff": 93, "fh": 11, "fi": [51, 97], "field": [1, 4, 20, 23, 60, 61, 96], "file": [1, 2, 4, 6, 8, 9, 10, 12, 13, 16, 17, 19, 20, 21, 22, 23, 24, 25, 26, 28, 29, 30, 31, 32, 33, 34, 36, 38, 39, 41, 42, 43, 45, 46, 47, 49, 51, 54, 56, 57, 58, 59, 61, 62, 64, 65, 67, 69, 72, 75, 76, 77, 78, 79, 80, 82, 83, 86, 88, 89, 92, 94, 95, 96, 97, 98], "file_list": 2, "file_nam": 23, "file_path": 60, "filenam": [1, 2, 4, 10, 12, 13, 20, 23, 24, 25, 26, 38, 39, 41, 43, 45, 47, 51, 55, 59, 60, 77, 92, 96], "filepath": [1, 60], "files_to_append": 2, "filesize_mbyt": [20, 55], "filesystem": [0, 1, 4, 6, 11, 13, 20, 23, 25, 26, 30, 31, 32, 33, 34, 38, 41, 43, 45, 46, 47, 48, 51, 52, 55, 60, 61, 67, 68, 70, 72, 75, 76, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 91, 92, 93], "filesystem_check": 83, "filesystem_nam": [12, 26], "filesystembas": [9, 12], "filesystembtrf": 12, "filesystembuild": 9, "filesystemext2": 12, "filesystemext3": 12, "filesystemext4": 12, "filesystemfat16": 12, "filesystemfat32": 12, "filesystemisof": 12, "filesystemsetup": 12, "filesystemsquashf": 12, "filesystemxf": 12, "filet": 1, "fill": [54, 72], "fillup": 97, "filter": [1, 46], "final": [1, 23, 45, 47, 49, 51, 58, 60, 64, 65, 72, 86], "financi": 29, "find": [1, 30, 45, 46, 54, 59, 62, 69, 72, 93], "fine": [45, 65, 77], "fingerprint": 86, "finish": [33, 45, 89], "firefox": 63, "firmwar": [7, 13, 52, 60, 68, 80, 82, 86, 90, 91], "firmware_inst": 7, "first": [1, 4, 15, 19, 26, 28, 30, 33, 38, 41, 43, 45, 46, 51, 53, 54, 57, 60, 64, 68, 74, 76, 77, 80, 81, 82, 89, 93, 96], "firstboot": [51, 97], "fit": [1, 41, 84, 96], "fix": [21, 23, 26, 33, 54, 60, 80, 82, 85, 93], "fixtur": 58, "flag": [1, 15, 21, 23, 30, 32, 54, 60, 78], "flag_nam": [1, 15], "flat": 93, "flavor": [77, 78], "flaw": 60, "flexibl": [61, 81, 82], "flip": 80, "float": 23, "fmt": 1, "focu": 75, "fog": 96, "fold": 68, "folder": [1, 21, 45, 47, 51, 65, 67, 69, 77, 89, 92], "follow": [1, 11, 16, 18, 21, 22, 23, 24, 28, 29, 30, 31, 32, 33, 34, 38, 39, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 60, 61, 62, 63, 67, 68, 69, 72, 74, 75, 77, 78, 79, 80, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98], "follow_link": 23, "font": 1, "foo": 60, "foo_app": 47, "foo_app_sourc": 47, "foo_profil": 77, "foobar": [10, 58], "forbidden": 1, "forc": [1, 14, 23, 46, 51, 60], "force_mbr": 60, "force_res": 46, "force_s": 85, "force_trailing_slash": 25, "foreign": 68, "forget": 77, "form": [1, 6, 14, 23, 24, 39, 53, 59, 60, 62, 77, 82, 94, 95], "format": [1, 9, 18, 21, 23, 25, 28, 29, 32, 33, 34, 36, 38, 39, 41, 43, 45, 46, 47, 48, 49, 52, 53, 54, 55, 57, 60, 64, 68, 69, 76, 85, 87, 89, 92, 93], "format_messag": 1, "format_nam": 21, "format_to_variable_valu": 23, "formatopt": [33, 60, 85], "formatt": 1, "former": [1, 31], "fortun": 92, "forward": [1, 21, 29, 33, 54], "found": [1, 9, 13, 18, 21, 23, 32, 38, 45, 49, 51, 54, 57, 60, 63, 73, 74, 77, 79, 82, 87, 94, 95], "fourth": 60, "fragment": 23, "framework": [33, 38, 60, 61, 85, 86, 87, 89], "franki": 56, "free": [1, 30, 37, 39, 46, 54, 60, 64, 80, 82, 83, 89], "freespac": [30, 83], "friend": 15, "from": [1, 4, 6, 7, 9, 10, 11, 12, 13, 14, 15, 19, 20, 21, 22, 23, 24, 25, 26, 28, 29, 30, 31, 32, 33, 34, 36, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 51, 52, 54, 55, 56, 57, 59, 60, 61, 62, 64, 65, 67, 72, 73, 74, 75, 76, 77, 79, 80, 82, 84, 87, 89, 90, 91, 93, 96, 98], "fsbteb0": 67, "fscreateopt": [1, 60, 74], "fsmountopt": [1, 60], "fstab": [23, 26, 60, 76, 80, 82], "fstype": 60, "ftp": [41, 49, 60, 93, 96], "fulfil": 1, "full": [6, 46, 54, 60, 69, 88], "fulli": [45, 51, 60, 65, 77, 88], "fullsiz": 1, "function": [1, 21, 23, 45, 46, 54, 55, 58, 60, 66, 68, 73, 75, 80, 89, 94, 95, 96], "further": [1, 4, 14, 20, 29, 32, 33, 34, 36, 38, 45, 47, 48, 51, 54, 58, 60, 61, 65, 74, 75, 77, 78, 81, 84, 85, 86, 87, 88, 89, 90, 91, 92, 94, 95], "furthermor": [34, 48, 77, 89], "fuse": 67, "futher": 33, "futur": 45, "g": [1, 2, 8, 11, 12, 21, 23, 24, 33, 36, 37, 38, 45, 54, 60, 61, 65, 71, 75, 78, 79, 80, 82, 83, 89, 93], "gap": 82, "gawk": 79, "gb": [1, 22, 33, 37, 60], "gce": [33, 60, 87], "gcm": 60, "gdisk": [15, 82], "geco": 86, "gen": 54, "gener": [1, 4, 11, 21, 22, 30, 31, 35, 39, 41, 43, 45, 46, 49, 51, 53, 54, 60, 62, 63, 64, 65, 66, 68, 73, 74, 77, 83, 89, 90, 91, 92, 93, 94, 95, 96], "geniu": 56, "geometri": [1, 30, 37, 60, 61, 82, 87], "get": [1, 6, 17, 19, 20, 21, 22, 25, 56, 57, 60, 61, 74, 77, 79, 80, 82, 84, 87, 88, 89, 93], "get_": 6, "get_additional_metadata": 21, "get_additional_vagrant_config_set": 21, "get_archive_image_typ": 1, "get_archives_target_dir": 1, "get_attribut": 1, "get_bios_image_nam": 1, "get_bios_module_directory_nam": 1, "get_blkid": 25, "get_bls_loader_entries_dir": 1, "get_boot_cmdlin": 6, "get_boot_description_directori": 4, "get_boot_image_description_path": 1, "get_boot_image_strip_fil": 1, "get_boot_label": 20, "get_boot_nam": 4, "get_boot_path": 6, "get_boot_them": 6, "get_boot_timeout_second": 6, "get_bootloader_config_opt": 1, "get_bootloader_install_opt": 1, "get_bootloader_opt": 1, "get_bootloader_shim_opt": 1, "get_bootstrap_arch": 1, "get_bootstrap_archives_target_dir": 1, "get_bootstrap_collect": 1, "get_bootstrap_collection_typ": 1, "get_bootstrap_fil": 1, "get_bootstrap_ignore_packag": 1, "get_bootstrap_packag": 1, "get_bootstrap_package_nam": 1, "get_bootstrap_packages_sect": 1, "get_bootstrap_product": 1, "get_build_type_bootloader_bl": 1, "get_build_type_bootloader_consol": 1, "get_build_type_bootloader_nam": 1, "get_build_type_bootloader_sect": 1, "get_build_type_bootloader_securelinux_sect": 1, "get_build_type_bootloader_serial_line_setup": 1, "get_build_type_bootloader_settings_sect": 1, "get_build_type_bootloader_targettyp": 1, "get_build_type_bootloader_timeout": 1, "get_build_type_bootloader_timeout_styl": 1, "get_build_type_bootloader_use_disk_password": 1, "get_build_type_bundle_format": 1, "get_build_type_containerconfig_sect": 1, "get_build_type_format_opt": 1, "get_build_type_machine_sect": 1, "get_build_type_nam": 1, "get_build_type_oemconfig_sect": 1, "get_build_type_partitions_sect": 1, "get_build_type_s": 1, "get_build_type_spare_part_fs_attribut": 1, "get_build_type_spare_part_s": 1, "get_build_type_system_disk_sect": 1, "get_build_type_unpartitioned_byt": 1, "get_build_type_vagrant_config_sect": 1, "get_build_type_vmconfig_entri": 1, "get_build_type_vmdisk_sect": 1, "get_build_type_vmdvd_sect": 1, "get_build_type_vmnic_entri": 1, "get_buildservice_env_nam": 1, "get_bundle_compress": 1, "get_byte_s": 20, "get_canonical_volume_list": 26, "get_collect": 1, "get_collection_modul": 1, "get_collection_typ": 1, "get_command": 1, "get_command_arg": 1, "get_common_functions_fil": 1, "get_contain": 1, "get_container_base_image_tag": 1, "get_container_compress": 1, "get_container_config": 1, "get_container_image_typ": 1, "get_container_nam": 11, "get_containers_sect": 1, "get_continue_on_timeout": 6, "get_credentials_verification_metadata_signing_key_fil": 1, "get_custom_rpm_bootstrap_macro_nam": 1, "get_custom_rpm_image_macro_nam": 1, "get_custom_rpm_macros_path": 1, "get_default_boot_mbyt": 1, "get_default_boot_timeout_second": 1, "get_default_bootload": 1, "get_default_container_created_bi": 1, "get_default_container_nam": 1, "get_default_container_subcommand": 1, "get_default_container_tag": 1, "get_default_disk_start_sector": 1, "get_default_efi_boot_mbyt": 1, "get_default_efi_partition_table_typ": 1, "get_default_firmwar": 1, "get_default_inode_s": 1, "get_default_legacy_bios_mbyt": 1, "get_default_live_iso_root_filesystem": 1, "get_default_live_iso_typ": 1, "get_default_package_manag": 1, "get_default_packager_tool": 1, "get_default_prep_mbyt": 1, "get_default_uri_typ": 1, "get_default_video_mod": 1, "get_default_volume_group_nam": 1, "get_derived_from_image_uri": 1, "get_description_sect": 1, "get_devic": [20, 26], "get_disabled_runtime_check": 1, "get_discoverable_partition_id": [1, 20], "get_disk_format_typ": [1, 21], "get_disk_image_typ": 1, "get_disk_start_sector": 1, "get_disksize_mbyt": 20, "get_distribution_name_from_boot_attribut": 1, "get_dracut_conf_nam": 1, "get_drivers_list": 1, "get_ec2_capable_firmware_nam": 1, "get_efi_capable_firmware_nam": 1, "get_efi_image_nam": 1, "get_efi_label": 20, "get_efi_module_directory_nam": 1, "get_efi_partition_s": 1, "get_efi_vendor_directori": 1, "get_enclaves_image_typ": 1, "get_entry_nam": 6, "get_error_cod": 1, "get_error_detail": 14, "get_error_output": 1, "get_exclude_list_for_non_physical_devic": 1, "get_exclude_list_for_removed_files_detect": 1, "get_exclude_list_for_root_data_sync": 1, "get_exclude_list_from_custom_exclude_fil": 1, "get_extension_xml_data": [1, 57], "get_failsafe_kernel_opt": 1, "get_filesystem": 25, "get_filesystem_image_typ": 1, "get_firmware_typ": 1, "get_format": 25, "get_frag": 23, "get_fs_create_option_list": 1, "get_fs_mount_option_list": 1, "get_fstab": [12, 26], "get_gfxmod": 6, "get_global_arg": 1, "get_grub_basic_modul": 1, "get_grub_bios_core_load": 1, "get_grub_bios_modul": 1, "get_grub_boot_directory_nam": 1, "get_grub_custom_argu": 1, "get_grub_efi_font_directori": 1, "get_grub_efi_modul": 1, "get_grub_ofw_modul": 1, "get_grub_path": 1, "get_grub_s390_modul": 1, "get_host_key_certif": 1, "get_host_templ": 17, "get_id": [15, 23], "get_ignore_packag": 1, "get_image_packages_sect": 1, "get_image_templ": 17, "get_image_vers": 1, "get_imported_root_imag": 1, "get_include_section_reference_file_nam": 1, "get_initrd_system": 1, "get_install_image_boot_default": 6, "get_install_templ": 8, "get_install_volume_id": 1, "get_installmedia_initrd_modul": 1, "get_iso_boot_path": 1, "get_iso_grub_load": 1, "get_iso_grub_mbr": 1, "get_iso_media_tag_tool": 1, "get_iso_templ": 8, "get_iso_tool_categori": 1, "get_kernel": 23, "get_kis_image_typ": 1, "get_label": 25, "get_legacy_bios_partition_s": 1, "get_live_dracut_modules_from_flag": 1, "get_live_image_typ": 1, "get_live_iso_persistent_boot_opt": 1, "get_local": 1, "get_logfil": 1, "get_luks_credenti": 1, "get_luks_format_opt": 1, "get_luks_key_length": 1, "get_lvm_overhead_mbyt": 1, "get_mapper_tool": 1, "get_max_size_constraint": 1, "get_menu_entry_install_titl": 6, "get_menu_entry_titl": 6, "get_min_partition_mbyt": 1, "get_min_volume_mbyt": 1, "get_mok_manag": 1, "get_mountpoint": [12, 26], "get_multiboot_install_templ": 8, "get_multiboot_iso_templ": 8, "get_obs_api_credenti": 1, "get_obs_api_server_url": 1, "get_obs_download_server_url": 1, "get_oci_archive_tool": 1, "get_oemconfig_oem_multipath_scan": 1, "get_oemconfig_oem_res": 1, "get_oemconfig_oem_systems": 1, "get_oemconfig_swap_mbyt": 1, "get_oemconfig_swap_nam": 1, "get_package_chang": 1, "get_package_manag": 1, "get_package_sect": 1, "get_packages_sect": 1, "get_part_mapper_tool": 1, "get_partit": 1, "get_partition_count": 25, "get_partition_table_typ": 1, "get_pid": 1, "get_platform_nam": [1, 21], "get_preferences_sect": 1, "get_prep_partition_s": 1, "get_prepar": 1, "get_product": 1, "get_profile_fil": 1, "get_public_partition_id_map": 20, "get_publish": 1, "get_qemu_option_list": 21, "get_recovery_spare_mbyt": 1, "get_release_vers": 1, "get_removed_files_nam": 1, "get_repo_typ": 19, "get_repositories_signing_kei": 1, "get_repository_sect": 1, "get_repository_sections_used_for_build": 1, "get_repository_sections_used_in_imag": 1, "get_result": 23, "get_root_filesystem_uuid": 1, "get_root_label": 20, "get_root_partition_uuid": 1, "get_root_volume_nam": [6, 12, 26], "get_rpm_check_signatur": 1, "get_rpm_excludedoc": 1, "get_rpm_local": 1, "get_rpm_locale_filt": 1, "get_runtime_checker_metadata": 1, "get_schema_fil": 1, "get_schematron_module_nam": 1, "get_servicenam": 1, "get_set": 23, "get_shared_cache_loc": 1, "get_shim_load": 1, "get_shim_vendor_directori": 1, "get_signed_grub_load": 1, "get_size_mbyt": 12, "get_snapper_config_template_fil": 1, "get_solvable_loc": 1, "get_strip_files_to_delet": 1, "get_strip_libraries_to_keep": 1, "get_strip_list": 1, "get_strip_tools_to_keep": 1, "get_swapsize_mbyt": 1, "get_sync_opt": 1, "get_system_arch": 1, "get_system_archives_target_dir": 1, "get_system_collect": 1, "get_system_collection_typ": 1, "get_system_fil": 1, "get_system_ignore_packag": 1, "get_system_packag": 1, "get_system_product": 1, "get_target_file_path_for_format": 21, "get_temp_loc": 1, "get_templ": [21, 22], "get_to_become_deleted_packag": 1, "get_tool_nam": 13, "get_unsigned_grub_load": 1, "get_us": 1, "get_user_group": 1, "get_users_sect": 1, "get_uuid": [20, 25], "get_vagrant_config_virtualbox_guest_addit": 1, "get_vendor_grubenv": 1, "get_video_mode_map": 1, "get_volum": [1, 6, 12, 26], "get_volume_group_nam": 1, "get_volume_id": 1, "get_volume_manag": 1, "get_volume_mbs": 26, "get_xen_hypervisor": 23, "get_xsl_stylesheet_fil": 1, "get_xz_compression_opt": 1, "get_xz_opt": 1, "getlogflag": 1, "getloglevel": 1, "getroot": 57, "gfxmode": 60, "gfxterm": 60, "gib": 80, "giga": 82, "gigabyt": 33, "git": [38, 63, 64, 68, 69], "gitconfig": 54, "github": [33, 38, 54, 62, 63, 68, 69], "gitlab": 54, "give": [51, 54, 77], "given": [1, 13, 14, 18, 19, 20, 23, 24, 25, 26, 28, 30, 34, 36, 46, 51, 60, 61, 67, 68, 69, 79, 93, 94, 95], "glibc": 45, "glob": 16, "global": [1, 36, 37, 39, 40, 41, 42, 43, 44, 50, 54, 58, 60], "gnu": [2, 47], "gnupg": 79, "go": 89, "goal": [30, 73], "goe": [56, 89], "gompa": 22, "good": 77, "googl": [21, 33, 60, 61, 62, 76], "got": [1, 21, 68, 93], "gpg": [1, 49, 54, 63], "gpg2": 54, "gpgsign": 54, "gpt": [1, 20, 60], "gpt2": 92, "gpt_hybrid_mbr": 60, "gq": 54, "gracefulli": 47, "grant": 1, "graphic": [6, 8, 60], "grasp": 54, "greater": 26, "grei": 38, "group": [1, 14, 18, 23, 26, 30, 47, 53, 60, 62, 68, 75, 83, 86, 89, 93, 95], "group_a": 60, "group_add": 23, "group_b": 60, "group_c": 60, "group_exist": 23, "group_list": 60, "group_nam": 23, "groupadd": 23, "grow": [36, 72], "growpart": 86, "grub": [1, 6, 20, 30, 32, 46, 60, 74, 86, 91, 92, 96], "grub2": [1, 13, 33, 47, 60, 68, 76, 84, 85, 86, 87, 89, 96], "grub2_s390x_emu": [6, 60], "grub_directory_nam": 6, "grub_loader_typ": 1, "grub_templ": 60, "guarante": [12, 26, 60, 68], "guest": [1, 21, 29, 33, 89], "guest_os_key_map": 33, "guest_os_t": 33, "guesto": 33, "guid": [1, 20, 60, 63, 82], "guid_str": 60, "guidelin": 54, "gwip": 54, "gz": [6, 21, 23, 45, 47, 64, 65], "gzip": [2, 25, 60], "h": [1, 24, 29, 33, 36, 37, 38, 39, 40, 41, 42, 43, 44, 56], "ha": [1, 6, 7, 13, 14, 15, 21, 22, 23, 26, 30, 33, 34, 46, 47, 51, 52, 54, 56, 60, 61, 63, 67, 68, 74, 75, 77, 80, 81, 82, 83, 85, 86, 87, 90, 91, 92, 93, 94, 95, 98], "hack": 71, "had": 23, "half": [46, 60], "hand": [46, 48, 77], "handi": 60, "handl": [1, 6, 16, 23, 33, 49, 52, 56, 57, 60, 65, 74, 77, 79, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 94, 95], "handler": 1, "happen": [1, 23, 26, 36, 46, 60, 67, 81], "hard": [6, 23, 36, 47, 60, 92], "harddisk": 60, "hardli": 77, "hardwar": [30, 33, 46, 60, 62, 64, 81, 93], "has_fail": 14, "has_graph": 8, "has_initrd_support": 4, "has_iso_hybrid_cap": 13, "has_journ": 60, "has_package_chang": 1, "has_raw_disk": 21, "has_seri": 8, "hash": [9, 10, 12, 53, 60, 93], "hash_blksiz": 60, "hash_start_block": 60, "hash_typ": 60, "hashicorp": 89, "hat": 60, "have": [1, 23, 26, 28, 30, 34, 36, 43, 45, 46, 47, 51, 52, 54, 58, 60, 62, 65, 69, 72, 75, 77, 79, 82, 83, 84, 89, 93, 96], "haven": 74, "hd0": 92, "hda": 30, "header": [1, 60], "healthcar": 29, "heavili": 46, "help": [24, 36, 37, 38, 39, 40, 41, 42, 43, 44, 51, 52, 54, 56, 80, 89], "help_": 1, "helper": [1, 13, 23, 24, 51, 58], "henc": 61, "here": [6, 10, 11, 13, 15, 21, 30, 32, 34, 59, 60, 61, 63, 67, 72, 74, 77, 82, 88, 89], "heterogen": 93, "hex": [1, 23, 41, 43, 49], "hidden": [13, 60], "hidden_fil": 13, "hierachi": 1, "hierarch": 26, "high": 83, "higher": [60, 64], "highest": 49, "highli": [29, 60, 61], "hipervisor": 9, "histori": [1, 10, 34], "hkd_ca_cert": 60, "hkd_cert": 60, "hkd_revocation_list": 60, "hkd_sign_cert": 60, "hmac": 60, "hoagjawxduvgsxydqtbhxlkjniol1mgbltdbhnyhu4k": 67, "hold": [20, 26, 28, 46, 80, 84], "holder": 93, "hollywood": 56, "home": [23, 53, 60, 68, 80, 86, 89], "home_path": 23, "hook": [36, 49, 57, 60], "host": [1, 16, 20, 23, 28, 29, 30, 34, 38, 41, 43, 45, 47, 49, 51, 54, 55, 60, 63, 64, 67, 68, 70, 71, 72, 77, 79, 83, 93], "host_dir": 23, "hostnam": 22, "how": [1, 26, 27, 28, 29, 30, 31, 32, 33, 34, 41, 43, 46, 47, 51, 54, 55, 57, 60, 61, 63, 67, 68, 69, 74, 75, 77, 80, 83, 85, 86, 87, 90, 91, 92, 93, 94, 95, 96, 97, 98], "howev": [1, 20, 23, 31, 51, 60, 63, 71, 73, 75, 77, 79, 80, 81, 82, 91], "html": [21, 33, 38, 46], "http": [1, 21, 28, 29, 30, 31, 33, 34, 38, 41, 46, 49, 54, 55, 56, 57, 60, 63, 68, 69, 77, 93], "human": [23, 62, 64], "hvmloader": [33, 86], "hwversion": 33, "hybrid": [1, 9, 15, 20, 27, 30, 60, 61, 90, 91, 92, 94], "hybridpersist": [32, 60], "hybridpersistent_filesystem": [32, 60], "hyper": 85, "hypervisor": [1, 6, 8, 23, 29], "i": [1, 2, 4, 6, 7, 9, 11, 12, 13, 14, 15, 16, 18, 19, 20, 21, 22, 23, 24, 25, 26, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 67, 68, 71, 72, 73, 74, 75, 77, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 91, 92, 93, 94, 95, 96, 97, 98], "i386": [68, 96], "i585": 33, "i686": 33, "i8042": 29, "ia32_efi": 96, "ia64_efi": 96, "ib": 41, "ibgzdjkplwjff8zrq01a8ex8k2fjrqt": 67, "ibm": 60, "icon": 34, "id": [1, 6, 14, 20, 22, 23, 25, 28, 29, 30, 33, 34, 39, 46, 51, 53, 54, 60, 61, 80, 84, 86, 93], "id128": 20, "id_typ": 25, "ident": [60, 80, 92, 93], "identif": [33, 34, 60, 92], "identifi": [1, 6, 24, 29, 39, 41, 43, 60, 61, 80, 82], "identifier_from_name_attr": 82, "ifac": 95, "ifnam": [85, 86, 87], "ifor": 34, "ifup": [30, 93], "ifupdown": 79, "ignor": [1, 23, 36, 41, 43, 77, 83], "ignore_recommend": 18, "illustr": [28, 68], "im": [51, 54], "imag": [0, 1, 6, 9, 10, 11, 12, 13, 14, 16, 17, 20, 21, 22, 23, 24, 29, 35, 38, 39, 40, 41, 42, 43, 44, 47, 49, 50, 53, 55, 57, 58, 62, 64, 67, 70, 71, 73, 75, 77, 79, 80, 81, 82, 83, 84, 95, 97, 98], "image_description_directori": 97, "image_format": 21, "image_id": 23, "image_type_nam": 60, "imagebuild": 9, "imageid": [23, 60], "imageidentifi": 4, "imageinclud": [1, 23, 41, 43, 49, 60], "imageonli": [41, 43, 49, 60], "imageroot": 1, "img": [30, 33, 46, 60, 72], "immedi": 47, "impact": [60, 82], "implement": [1, 4, 6, 7, 11, 12, 13, 14, 15, 16, 19, 20, 21, 23, 24, 26, 30, 46, 51, 54, 56, 57, 60, 62, 67, 80, 89, 93, 94, 95], "import": [1, 16, 23, 29, 32, 41, 42, 43, 46, 48, 51, 54, 55, 56, 57, 60, 61, 63, 80, 86, 90, 92, 98], "import_cdroot_fil": 23, "import_descript": 23, "import_fil": 23, "import_image_identifi": 23, "import_overlay_fil": 23, "import_repositories_marked_as_imageinclud": 23, "import_system_description_el": 4, "import_trusted_kei": 16, "importlib": 1, "imposs": [1, 77], "improv": 58, "in_sub_dir": 6, "inact": 60, "includ": [1, 4, 9, 13, 14, 18, 21, 22, 23, 28, 29, 30, 31, 33, 34, 36, 38, 45, 46, 47, 49, 50, 51, 54, 61, 62, 63, 64, 65, 77, 80, 82, 88, 89, 95], "include_fil": 4, "include_modul": 4, "include_unpartit": 1, "inclus": [47, 54, 60], "incompat": [54, 67, 70], "incomplet": [1, 23], "inconsist": [1, 23, 41, 51, 74], "incorpor": [47, 60], "increas": [1, 23], "increment": 60, "incur": 60, "indent": 22, "independ": [23, 47, 68, 81], "index": 63, "indic": [1, 4, 6, 13, 14, 15, 19, 24, 30, 41, 43, 60, 82, 83, 93], "indirect": [58, 73], "indirectli": 58, "individu": [6, 52, 58, 60, 61, 93, 98], "infer": 25, "influenc": [32, 60, 73, 93, 94], "info": [1, 35, 38, 51], "infofilt": 1, "inform": [1, 4, 6, 12, 14, 16, 18, 19, 20, 21, 22, 23, 24, 25, 26, 29, 31, 32, 33, 34, 36, 38, 39, 40, 41, 43, 45, 46, 49, 51, 57, 58, 59, 60, 61, 64, 65, 67, 68, 71, 74, 75, 79, 81, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98], "infrastructur": [11, 30, 31, 76], "inherit": [1, 48, 56], "ini": 1, "init": [11, 23, 29, 46, 51, 79, 86, 87, 89], "init_iso_creation_paramet": 13, "initi": [1, 4, 6, 7, 11, 12, 14, 15, 16, 21, 23, 26, 30, 41, 43, 45, 46, 47, 51, 54, 60, 64, 65, 79, 93], "initramf": 46, "initrd": [1, 4, 6, 9, 27, 29, 30, 46, 51, 60, 61, 80, 84, 87, 91, 92, 93, 94, 95], "initrd_fil": 60, "initrd_nam": 4, "initrd_system": [1, 46, 60, 84, 87], "inject": 77, "inner": 60, "inod": [1, 74], "inode_s": 74, "input": [1, 23, 60, 96], "insecur": [51, 89], "insert": [22, 33, 51, 54, 57, 60, 63, 96], "insid": [1, 17, 21, 22, 23, 28, 47, 49, 51, 54, 58, 59, 60, 64, 65, 67, 68, 72, 77, 78, 95], "inspect": [46, 54, 68], "inst_hook": 46, "inst_multipl": 46, "instal": [0, 1, 4, 6, 8, 14, 16, 23, 24, 28, 32, 33, 34, 36, 38, 41, 43, 44, 45, 46, 47, 49, 51, 52, 56, 58, 59, 60, 61, 62, 64, 65, 67, 69, 77, 79, 82, 84, 85, 86, 87, 89, 91, 92, 93, 94, 95], "install_bootstrap": 23, "install_continue_on_timeout": 60, "install_initrd": 4, "install_lang": 60, "install_media": 4, "install_packag": 23, "install_requir": 7, "install_system": 23, "installboot": [6, 60, 84], "installdevic": 46, "installed_kernel": 4, "installimagebuild": 9, "installiso": [1, 9, 30, 46, 60, 61, 84], "installkernel": 46, "installmedia": 30, "installopt": 60, "installprovidefailsaf": 60, "installpx": [1, 9, 30, 46, 60, 61], "installstick": [1, 9, 46], "instanc": [1, 4, 6, 7, 8, 9, 12, 14, 15, 16, 18, 19, 20, 21, 23, 24, 26, 28, 29, 33, 45, 49, 60, 83, 86, 87, 89], "instead": [1, 16, 25, 38, 46, 49, 54, 58, 60, 61, 62, 63, 65, 77, 89], "instmod": 46, "instruct": [30, 46, 47, 48, 54, 60, 63, 75, 77, 83, 93, 96, 97], "int": [1, 6, 12, 14, 15, 16, 20, 21, 23, 25, 26], "intanc": 26, "integ": 49, "integr": [46, 54, 60, 63, 67, 77, 79], "integrity_keyfil": 60, "integrity_legacy_hmac": 60, "integrity_metadata_key_descript": 60, "integrity_root": 9, "integritydevic": 9, "integritysetup": 60, "intel_lean_cli": 96, "intellectu": 29, "intend": [32, 60], "intent": 60, "intention": 1, "interact": [30, 46, 60, 64, 65, 67, 97], "interf": [60, 61], "interfac": [1, 12, 19, 24, 26, 57, 60, 61, 68, 77, 89, 94, 95], "interfer": 32, "intermedi": [16, 19, 23], "intern": [1, 22, 33, 41], "internal_hash": 60, "interpret": [12, 54, 60, 83], "introduc": 45, "invalid": 1, "investig": 60, "invoc": 1, "invok": [1, 12, 26, 45, 48, 49, 51, 54, 56, 60, 65, 69, 77, 89], "involv": 60, "io": [1, 68], "ip": [89, 93, 95, 96], "ipappend": 93, "iproute2": 79, "iptabl": 79, "iputil": 79, "ipx": 96, "is_buildservice_work": 1, "is_loop": [20, 26], "is_mount": 1, "is_obs_publ": 1, "is_ppc64_arch": 1, "is_prepar": 4, "is_publ": 23, "is_remot": 23, "is_root_volum": 1, "is_uptod": 19, "is_x86_arch": 1, "is_xen_guest": 1, "is_xen_serv": 1, "isc": 79, "iso": [1, 6, 8, 9, 12, 27, 30, 38, 41, 45, 46, 47, 49, 51, 52, 55, 60, 61, 62, 65, 76, 84], "iso_boot": 6, "iso_control": 22, "iso_path": 92, "iso_setup": 22, "iso_tool": 0, "isofil": 13, "isohybrid": 91, "isoinfo": 1, "isol": 29, "isomd5sum": 1, "isoscan": 46, "isotool": 13, "isotoolsbas": 13, "isotoolsxorriso": 13, "issu": [1, 14, 42, 54, 67, 70, 74, 75, 77, 89], "item": [1, 2, 46, 60], "item_to_match": 1, "items_to_complet": 1, "iter": [1, 23], "its": [1, 9, 20, 23, 24, 25, 30, 33, 39, 46, 47, 49, 51, 52, 54, 57, 59, 60, 61, 63, 65, 71, 75, 77, 79, 80, 81, 82, 83, 84, 93], "itself": [1, 4, 22, 23, 30, 46, 49, 51, 60, 61, 63, 65, 67, 68, 77, 81, 89, 93], "ix86": [1, 33, 71], "j": 24, "j3sodpotpog8pinwrx6": 67, "jammi": 72, "java": 52, "jbod": 46, "jeo": 77, "jing": 52, "job": [1, 18, 67, 75, 79], "job_nam": 18, "join": 54, "journal": 60, "json": [1, 21, 23, 77], "judg": 60, "just": [1, 26, 45, 57, 60, 69, 70, 75, 77, 79, 84], "justdoit": 56, "k": [12, 29, 57], "kb": [1, 12, 33], "kbd": 60, "kbyte": 84, "kconfig": 51, "keep": [1, 23, 25, 30, 32, 42, 46, 51, 60, 63, 71, 75, 77, 88, 91, 92], "keep_sourc": 25, "keep_source_on_compress": 25, "kei": [1, 4, 9, 10, 12, 16, 20, 23, 24, 25, 28, 41, 42, 43, 51, 54, 60, 63, 67, 86, 88, 89, 91, 92], "kept": [31, 51], "kernel": [1, 4, 6, 9, 14, 27, 28, 29, 30, 32, 46, 47, 51, 60, 61, 68, 75, 83, 85, 86, 87, 89, 91, 92, 94, 95], "kernel_fil": 60, "kernel_file_nam": 4, "kernel_filenam": 4, "kernel_hex_mod": 1, "kernel_nam": [4, 23], "kernel_typ": 23, "kernel_vers": 4, "kernelcmdlin": [29, 31, 60, 84, 85, 86, 87], "kernelnam": 23, "kexec": [9, 30, 60, 84], "keyboard": 23, "keyfil": [20, 60, 88], "keyid": 54, "keymap": 60, "keynam": 1, "keyr": [60, 88], "keytabl": [51, 68], "keyword": 1, "ki": [1, 27, 47, 52, 60, 61, 95], "kill": 1, "kisbuild": 9, "kiwi": [0, 27, 28, 29, 30, 31, 32, 33, 34, 35, 45, 46, 47, 48, 49, 50, 52, 54, 56, 58, 59, 60, 61, 62, 63, 64, 65, 67, 68, 69, 70, 71, 72, 73, 74, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 97, 98], "kiwi_": [41, 80], "kiwi_biosgrub": [20, 80], "kiwi_boot_timeout": 93, "kiwi_bootpart": [20, 80], "kiwi_bootpartclon": 20, "kiwi_bootpartclone1": 80, "kiwi_box": 72, "kiwi_boxed_plugin": 67, "kiwi_compress": 51, "kiwi_delet": 51, "kiwi_driv": 51, "kiwi_efipart": [20, 80], "kiwi_fil": 24, "kiwi_git_checkout": 67, "kiwi_homepart": 80, "kiwi_homepartclone1": 80, "kiwi_homepartclone2": 80, "kiwi_inam": 51, "kiwi_ivers": 51, "kiwi_kernel_opt": 93, "kiwi_keyt": 51, "kiwi_languag": 51, "kiwi_oembootwait": 30, "kiwi_oemreboot": 30, "kiwi_oemrebootinteract": 30, "kiwi_oemrootmb": 30, "kiwi_oemshutdown": 30, "kiwi_oemshutdowninteract": 30, "kiwi_oemsilentboot": 30, "kiwi_oemswap": 30, "kiwi_oemswapmb": 30, "kiwi_oemtitl": 30, "kiwi_oemunattend": 30, "kiwi_plugin": 56, "kiwi_preppart": 20, "kiwi_profil": 51, "kiwi_raiddev": 20, "kiwi_raidpart": 20, "kiwi_readonlypart": 20, "kiwi_relax_plugin": 56, "kiwi_rootpart": [20, 80], "kiwi_rootpartclone1": 80, "kiwi_sparepart": 20, "kiwi_stackbuild_plugin": 68, "kiwi_swappart": 20, "kiwi_timezon": 51, "kiwi_typ": 51, "kiwianymarkuppluginerror": 1, "kiwiarchivesetuperror": 1, "kiwiarchivetarerror": 1, "kiwibootimagesetuperror": 1, "kiwibootloaderconfigsetuperror": 1, "kiwibootloaderdiskpassworderror": 1, "kiwibootloadergrubdataerror": 1, "kiwibootloadergrubfonterror": 1, "kiwibootloadergrubinstallerror": 1, "kiwibootloadergrubmoduleserror": 1, "kiwibootloadergrubplatformerror": 1, "kiwibootloadergrubsecurebooterror": 1, "kiwibootloaderinstallsetuperror": 1, "kiwibootloadertargeterror": 1, "kiwibootloaderziplinstallerror": 1, "kiwibootloaderziplplatformerror": 1, "kiwibootloaderziplsetuperror": 1, "kiwibootstrapphasefail": [1, 23], "kiwibuildaherror": 1, "kiwibundleerror": 1, "kiwicommandcapabilitieserror": 1, "kiwicommanderror": 1, "kiwicommandnotfound": 1, "kiwicommandnotload": 1, "kiwicompressionformatunknown": 1, "kiwiconfigfileformatnotsupport": 1, "kiwiconfigfilenotfound": 1, "kiwicontainerbuildererror": 1, "kiwicontainerimagesetuperror": 1, "kiwicontainersetuperror": 1, "kiwicredentialserror": 1, "kiwicustompartitionconflicterror": 1, "kiwidatastructureerror": 1, "kiwidebianbootstraperror": 1, "kiwidecodingerror": 1, "kiwidescriptioninvalid": 1, "kiwideviceprovidererror": 1, "kiwidiskbootimageerror": 1, "kiwidiskformatsetuperror": 1, "kiwidiskgeometryerror": 1, "kiwidistributionnameerror": 1, "kiwienclavebootimageerror": 1, "kiwienclaveformaterror": 1, "kiwierror": 1, "kiwiextensionerror": 1, "kiwifil": 38, "kiwifileaccesserror": 1, "kiwifilenotfound": 1, "kiwifilesystemsetuperror": 1, "kiwifilesystemsyncerror": 1, "kiwiformatsetuperror": 1, "kiwihelpnocommandgiven": 1, "kiwiimageresizeerror": 1, "kiwiimportdescriptionerror": 1, "kiwiincludfilenotfounderror": 1, "kiwiinstallbootimageerror": 1, "kiwiinstallmediaerror": [1, 9], "kiwiinstallphasefail": [1, 23], "kiwiisometadataerror": 1, "kiwiisotoolerror": [1, 13], "kiwikernellookuperror": [1, 23], "kiwikisbootimageerror": [1, 9], "kiwilivebootimageerror": [1, 9], "kiwiloadcommandundefin": 1, "kiwilogfilesetupfail": 1, "kiwilogsocketsetupfail": 1, "kiwiloopsetuperror": 1, "kiwilukssetuperror": 1, "kiwimappeddeviceerror": 1, "kiwimarkupconversionerror": 1, "kiwimountkernelfilesystemserror": [1, 23], "kiwimountshareddirectoryerror": [1, 23], "kiwinotimplementederror": 1, "kiwiociarchivetoolerror": 1, "kiwioffseterror": 1, "kiwiosreleaseimporterror": 1, "kiwipackagemanagersetuperror": [1, 14], "kiwipackagesdeletephasefail": [1, 23], "kiwipartitionergptflagerror": 1, "kiwipartitionermsdosflagerror": 1, "kiwipartitionersetuperror": 1, "kiwipartitiontoosmallerror": 1, "kiwiprivilegeserror": 1, "kiwiprofilenotfound": 1, "kiwiraidsetuperror": 1, "kiwirepositorysetuperror": [1, 16], "kiwirequestedtypeerror": 1, "kiwirequesterror": [1, 14], "kiwiresizerawdiskerror": 1, "kiwiresulterror": [1, 23], "kiwirootdirexist": 1, "kiwirootimporterror": 1, "kiwirootinitcreationerror": [1, 23], "kiwirpmdirnotremoteerror": 1, "kiwiruntimeconfigfileerror": 1, "kiwiruntimeconfigformaterror": 1, "kiwiruntimeerror": 1, "kiwisatsolverjoberror": 1, "kiwisatsolverjobproblem": [1, 18], "kiwisatsolverpluginerror": 1, "kiwischemaimporterror": 1, "kiwiscriptfail": 1, "kiwiserv": 93, "kiwiservertyp": 93, "kiwisetupintermediateconfigerror": [1, 23], "kiwishellvariablevalueerror": [1, 23], "kiwisizeerror": 1, "kiwisolverrepositorysetuperror": 1, "kiwisystemdeletepackagesfail": [1, 23], "kiwisysteminstallpackagesfail": [1, 23], "kiwisystemupdatefail": [1, 23], "kiwitargetdirectorynotfound": 1, "kiwitemplateerror": 1, "kiwitypenotfound": 1, "kiwiumountbusyerror": 1, "kiwiunknownservicenam": 1, "kiwiuriopenerror": [1, 19], "kiwiuristyleunknown": [1, 23], "kiwiuritypeunknown": 1, "kiwivalidationerror": 1, "kiwivg": 83, "kiwivhdtagerror": 1, "kiwivolumegroupconflict": 1, "kiwivolumemanagersetuperror": [1, 9, 26], "kiwivolumerootiderror": 1, "kiwivolumetoosmallerror": 1, "kludg": 72, "kmgt": 46, "kmp": 89, "knife": 62, "know": [1, 52, 60, 67, 74, 93, 98], "knowledg": [65, 79], "known": [1, 23, 31, 36, 65, 96], "kvm": [21, 67, 68], "kwarg": 1, "l": [1, 10, 54, 63, 69, 92, 93], "label": [1, 10, 12, 20, 25, 26, 28, 41, 43, 55, 60, 83, 86, 93, 94, 95], "label_nam": 1, "lack": 2, "lain": 53, "land": 93, "languag": [1, 51, 60, 79], "larg": [30, 33, 52, 72, 77], "last": [40, 51, 60, 63, 77, 80, 81, 82, 94], "later": [1, 18, 23, 47, 51, 60, 68, 81, 88], "latest": [24, 36, 51, 60, 77], "latter": [21, 53, 83], "launch": [45, 60], "launcher": 34, "layer": [1, 12, 26, 32, 46, 60, 68, 95], "layout": [1, 6, 15, 20, 30, 45, 59, 60, 80, 82, 89], "lazi": 1, "ldl": 60, "lead": [1, 20, 36, 41, 47, 51, 58, 60, 68, 70, 71, 75], "leap": [28, 30, 32, 33, 38, 62, 63, 67, 68, 69, 77, 78, 83, 93], "leap_15_3": 58, "least": [1, 41, 43, 49, 60, 61, 62, 64, 84], "leav": [1, 60, 80, 82], "left": [1, 33, 34, 80], "leftov": 23, "legaci": [1, 9, 30, 31, 60, 76, 80], "legacy_bios_mod": 1, "legacyesx": 33, "len": 54, "length": 1, "less": [30, 46], "let": [30, 54, 60, 80, 84, 87, 93], "letter": [34, 54], "level": [1, 20, 22, 23, 24, 26, 38, 45, 49, 51, 52, 54, 55, 59, 60, 80, 82, 83, 93], "leverag": 80, "lib": [1, 46, 51, 60, 79, 83, 86, 97], "libburnia": 13, "libpam": 79, "librari": [1, 38, 46, 51, 83, 86], "libsolv": [1, 18], "libvirt": [21, 78, 89], "libvirtd": 89, "libvirtvagrantfil": 89, "libzypp": 16, "licens": [45, 59, 60, 61, 65], "light": [1, 38], "lightcolor": 1, "like": [1, 6, 14, 19, 25, 28, 30, 33, 34, 36, 45, 46, 47, 52, 54, 60, 61, 62, 64, 69, 73, 75, 77, 79, 80, 82, 84, 91, 92, 93, 98], "limit": [23, 30, 46, 54, 60, 62, 80, 82, 84], "line": [1, 14, 30, 31, 34, 38, 41, 43, 45, 46, 48, 50, 54, 60, 61, 62, 75, 77, 78, 93], "link": [16, 23, 51, 63, 77], "linter": 54, "linux": [1, 6, 11, 23, 27, 30, 34, 45, 46, 51, 60, 61, 64, 65, 74, 75, 77, 79, 82, 83, 88, 90, 92, 93, 94, 95], "linuxrc": [23, 46, 93], "list": [1, 2, 4, 9, 10, 11, 12, 13, 14, 15, 16, 18, 20, 21, 23, 24, 25, 26, 28, 30, 32, 33, 34, 35, 36, 41, 43, 46, 47, 48, 49, 51, 53, 54, 58, 59, 60, 61, 62, 63, 66, 67, 68, 74, 75, 77, 79, 80, 82, 83, 85, 86, 87, 88, 98], "list_iso": 13, "list_of_volum": 7, "listen": 1, "liter": [1, 6], "littl": 1, "live": [1, 6, 8, 27, 30, 38, 45, 46, 51, 52, 60, 61, 62, 65, 76, 90, 91], "live_system": 46, "liveimagebuild": 9, "livenet": 32, "liveo": 46, "ln": 51, "ln6tkw1p6uvvmuibagugnzfntdci91qw8ps1j": 67, "load": [1, 4, 6, 23, 24, 28, 29, 30, 33, 36, 46, 55, 57, 60, 61, 89, 91, 92, 94, 95], "load_boot_xml_descript": 4, "load_command": 1, "load_xml_descript": 24, "loadabl": 61, "loader": [1, 6, 13, 33, 60, 94, 95, 96], "loader_fil": 13, "local": [1, 23, 41, 45, 49, 51, 68, 86], "locat": [1, 16, 19, 23, 30, 38, 39, 41, 43, 46, 49, 50, 60, 72, 75, 81, 93, 95, 98], "lock_passwd": 86, "log": [1, 10, 38, 41, 46, 51, 55, 57, 60, 89, 96], "log_top": 1, "logfil": [1, 24, 38], "loggerschedulerfilt": 1, "logic": [1, 60, 82, 83], "login": [1, 11, 29, 60, 68, 89], "loglevel": 38, "logrecord": 1, "logsocket": 38, "long": [1, 54, 57, 75], "longer": [1, 31, 47, 60, 77, 80], "look": [1, 23, 45, 47, 49, 54, 57, 60, 61, 69, 80, 90, 91, 93], "lookup": [1, 6, 13, 23, 26, 46, 60, 82, 98], "lookup_path": [1, 6, 13], "loop": [1, 20, 26, 32, 41, 46, 51, 52, 55, 60, 92, 93], "loop0": 95, "loop_devic": 55, "loop_provid": 55, "loopback": [32, 46, 91, 92], "loopdevic": [12, 20, 55], "loos": 84, "losetup": 95, "losr": 30, "lost": [45, 91], "lot": 62, "low": [26, 82], "lower": [1, 60], "lowercas": 1, "lsblk": [90, 91], "lsilog": 33, "lsisas1068": 33, "luk": [1, 20, 46, 52, 60, 80, 88], "luks1": 60, "luks2": 60, "luks_root": 9, "luks_vers": 60, "luksdevic": [9, 20], "luksformat": 1, "lvm": [1, 20, 30, 46, 52, 60, 80, 83], "lvroot": 83, "lvswap": [1, 30], "lx": 82, "lx3vnc8zboowm6nhzqq4faqbxuh": 67, "lxboot": 80, "lxbootclone1": 80, "lxhome": 80, "lxhomeclone1": 80, "lxhomeclone2": 80, "lxml": 1, "lxroot": 80, "lxrootclone1": 80, "lyric": 56, "lz4": 60, "lzo": 60, "m": [1, 23, 29, 30, 32, 33, 37, 39, 47, 54, 60, 61, 69, 78, 82, 83, 84, 85, 86, 87, 93], "mac": [21, 22, 33], "mac_address": [22, 93], "machin": [1, 21, 22, 23, 30, 34, 45, 47, 48, 51, 61, 62, 64, 67, 68, 77, 79, 84, 86, 93, 94, 95], "machine_id": 4, "macro": [1, 14, 16, 23, 60], "made": [1, 49, 60, 62, 77, 82, 93], "magic": 51, "mai": [30, 31, 38, 45, 46, 47, 51, 58, 60, 61, 62, 63, 64, 65, 72], "mail": 62, "main": [1, 6, 13, 22, 24, 26, 36, 38, 39, 41, 43, 49, 52, 54, 55, 57, 60, 65, 77, 84], "mainli": 61, "maintain": [1, 10, 28, 34, 60, 89, 93], "mainten": 24, "major": [33, 39, 54, 60, 61, 71, 73, 74, 81, 93, 94, 95], "make": [1, 16, 20, 21, 24, 25, 28, 30, 32, 33, 34, 36, 37, 38, 41, 45, 46, 47, 48, 51, 54, 60, 63, 68, 72, 74, 75, 77, 79, 80, 81, 84, 85, 86, 87, 88, 90, 91, 93, 96], "man": [1, 23, 25, 46, 51, 56, 60], "man7": 46, "manag": [1, 14, 16, 17, 20, 23, 25, 26, 30, 41, 42, 43, 45, 47, 49, 51, 52, 54, 55, 56, 60, 61, 62, 63, 65, 68, 69, 77, 80, 82, 83], "mandatori": [33, 45, 47, 51, 53, 59, 60, 61, 68, 82, 89], "mangement": 1, "manger": 1, "mani": [23, 31, 46, 60, 61, 62, 63, 73, 80, 90, 91, 93], "manifest": 21, "manner": 54, "manual": [1, 24, 45, 54, 56, 60, 77, 78, 79, 90, 91, 93, 98], "map": [1, 6, 11, 15, 20, 26, 28, 57, 60, 72, 80, 81], "map_nam": 20, "map_partit": 20, "mappeddevic": [20, 26], "mapper": [1, 32], "mark": [1, 23, 26, 28, 32, 39, 45, 47, 58, 60], "markup": [1, 52, 60], "master": [1, 26, 60, 88], "match": [1, 14, 16, 20, 23, 24, 25, 28, 30, 34, 38, 45, 56, 60, 61, 62, 64, 65, 67, 69, 71, 79, 83, 85, 86, 87, 88, 94], "match_method": 1, "match_package_delet": 14, "match_package_instal": 14, "matcher": 1, "matrix": 62, "matter": [77, 84, 92], "mawk": 79, "max": [1, 25, 60], "max_cpu": 33, "max_memori": 33, "max_siz": 1, "maxdisk": 46, "maximum": [1, 30, 33, 46], "mb": [1, 33, 37, 46, 60], "mbr": [1, 15, 20, 23, 60, 82], "mbrid": [4, 6, 23], "mbsize": [1, 15, 20, 23, 26, 32, 46, 60], "mbyte": [1, 12, 20, 23, 60], "md": [16, 19, 20, 23, 41, 43, 49, 55, 68, 77, 79], "md0": 93, "md1": 93, "md5": [25, 30, 93], "md5sum": 93, "mdadm": 20, "mdraid": 60, "mdx": 20, "me": 53, "mean": [1, 23, 30, 31, 40, 41, 43, 46, 47, 49, 51, 55, 57, 60, 61, 68, 69, 75, 84, 90, 91, 92, 94, 95], "meaningless": 60, "meant": 20, "mechan": [52, 57, 89], "media": [1, 4, 6, 8, 9, 32, 45, 52, 60, 61, 62, 65, 89, 98], "media_path": 13, "media_tag_tool": 1, "mediacheck": [1, 13, 32, 60], "meet": [46, 85, 86, 87], "mega": 82, "megabyt": [1, 33, 83], "member": 60, "memori": [22, 29, 32, 33, 72, 84], "memory_setup": 22, "mention": [57, 61, 67, 68, 71, 75, 80], "menu": [6, 30, 60, 63, 90, 91, 92, 96], "merg": 19, "meson": 47, "messag": [1, 16, 23, 30, 38, 51, 60, 86], "message_format": 1, "met": 1, "meta": [6, 13, 34, 38, 77], "meta_data": 12, "metadata": [1, 6, 9, 11, 18, 19, 21, 23, 25, 28, 33, 34, 36, 41, 42, 43, 60, 61, 73, 74, 80, 89], "metadata_path": [34, 60], "metalink": [16, 29, 60], "method": [1, 4, 6, 7, 11, 12, 13, 14, 15, 16, 19, 20, 21, 22, 23, 24, 25, 26, 47, 51, 54, 56, 60, 62, 63, 77, 79, 81, 84, 93, 96], "mib": 80, "microdnf": 60, "microo": 68, "microsoft": [1, 33, 34, 60, 61, 76], "might": [14, 46, 51, 60, 63, 67, 74, 77, 81, 85, 86, 87, 88, 89], "migrat": 86, "mime": [1, 19], "min_cpu": 33, "min_memori": 33, "min_vers": 1, "mind": [30, 42, 46, 51, 63, 71, 77], "minim": [23, 60, 93], "minimum": [1, 26, 33, 60, 64], "minor": [39, 54, 60, 61, 94, 95], "mirror": [20, 29, 60, 93], "mirrorlist": [16, 60], "miss": [1, 20, 36, 38, 51, 60, 89], "mix": [6, 54], "mkconfig": [6, 60], "mkdir": [30, 46, 47, 68, 95, 97], "mke2f": [60, 74], "mkf": [60, 74], "mkimag": 96, "mknetdir": 96, "mkpac": 79, "mksquashf": 60, "ml": 60, "mnt": 94, "moddir": 46, "mode": [1, 6, 20, 23, 30, 32, 33, 46, 51, 54, 58, 60, 91, 92, 93, 95], "modern": [11, 51], "modif": [23, 45, 49, 51, 60, 61, 77, 81], "modifi": [23, 30, 45, 49, 51, 53, 54, 55, 60, 72, 75, 80, 81, 82, 89], "modprob": 23, "modul": [30, 32, 36, 46, 52, 54, 55, 56, 58, 60, 74, 86, 87, 89, 94, 95, 96, 97, 98], "modular": 60, "module_hotfix": 49, "mok": 1, "moment": [57, 60, 91], "monolithicflat": 33, "monolithicspars": 33, "more": [1, 6, 20, 23, 28, 29, 30, 36, 38, 45, 46, 49, 51, 54, 56, 59, 60, 61, 62, 63, 67, 68, 73, 74, 75, 79, 80, 86, 90, 92], "moreov": 2, "most": [12, 38, 46, 63, 73, 75, 77, 80, 81, 89, 91, 92, 93], "mostli": [46, 60, 65], "mount": [1, 6, 12, 23, 26, 38, 41, 46, 49, 51, 60, 67, 72, 80, 81, 82, 83, 84, 86, 88, 91, 92, 93, 94, 98], "mount_kernel_file_system": 23, "mount_list": 26, "mount_opt": 12, "mount_shared_directori": 23, "mount_stack": 23, "mount_volum": [12, 26], "mountabl": 9, "mountmanag": [1, 12, 26], "mountpoint": [1, 20, 26, 28, 80, 82, 83, 93], "move": [4, 14, 60, 68, 77, 82], "move_to_root": 1, "msdo": [1, 20, 60], "much": [54, 59, 77], "multiboot": 1, "multibuild": [77, 78], "multio": 92, "multipath": [1, 84, 86], "multipl": [1, 24, 28, 30, 33, 38, 40, 41, 42, 43, 44, 45, 47, 48, 53, 54, 57, 59, 60, 61, 68, 77, 83], "must": [1, 13, 16, 21, 22, 30, 34, 36, 38, 39, 41, 42, 43, 46, 48, 49, 50, 51, 52, 54, 56, 57, 59, 60, 67, 75, 77, 78, 80, 82, 84, 85, 86, 87, 89, 91, 92, 93, 94, 95, 96], "mutablemap": 1, "mutat": 58, "my": [34, 46, 47, 54, 89], "my_featur": 57, "my_plugin": 57, "my_plugin_a": 57, "my_plugin_b": 57, "my_tmp": 55, "myimag": [28, 29, 30, 31, 32, 33, 34, 38, 67, 69, 78], "myleap": 68, "mypx": 93, "myrepo": 55, "mytwtodai": 68, "myvagrantfil": 89, "n": [20, 23, 30, 39, 54, 58, 61, 93, 94, 95], "name": [1, 2, 4, 6, 7, 9, 10, 11, 12, 13, 14, 15, 16, 18, 19, 20, 21, 22, 23, 24, 25, 26, 28, 29, 30, 32, 33, 34, 38, 39, 41, 43, 44, 45, 46, 47, 48, 49, 51, 53, 54, 57, 59, 60, 61, 63, 64, 65, 67, 68, 77, 78, 79, 80, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97], "name_pattern": 61, "name_wit_a_": 23, "namedcollect": 1, "namedtupl": [1, 14], "namespac": [1, 48, 55, 56, 57, 60, 78], "namespace_nam": 1, "nativ": [28, 33, 46, 47, 51, 60, 71, 79], "natur": 60, "navig": 54, "nbd": [93, 95], "nbd0": 93, "nbdroot": 93, "nbywfl0": [53, 68], "ncpu": 33, "neal": 22, "nearli": 60, "necessari": [46, 47, 51, 54, 60, 77, 89], "need": [1, 4, 6, 7, 11, 12, 14, 18, 20, 21, 22, 23, 26, 30, 34, 46, 47, 51, 52, 56, 57, 58, 60, 61, 62, 63, 64, 67, 68, 69, 72, 74, 79, 80, 81, 82, 84, 86, 89, 91, 92, 93, 96, 97], "need_boot_partit": 20, "neither": 31, "nest": [1, 60], "net": [85, 86, 87, 96], "net_default_serv": 96, "netbas": 79, "netboot": [31, 46, 76], "network": [9, 22, 32, 38, 47, 60, 61, 62, 65, 76, 81, 89, 93], "network_connection_typ": 22, "network_driv": 22, "network_mac": 22, "network_setup": 22, "never": [23, 80, 83], "nevertheless": 77, "new": [1, 4, 7, 9, 10, 11, 12, 13, 14, 15, 16, 19, 20, 21, 22, 23, 24, 26, 28, 30, 32, 37, 38, 41, 43, 45, 46, 47, 54, 55, 57, 60, 61, 67, 68, 75, 79, 82, 93, 94, 98], "next": [35, 45, 60, 62, 63, 66, 68, 75, 77, 79, 89, 94, 96], "nf": [81, 93], "nfsroot": 93, "ng": [0, 1, 27, 28, 29, 30, 31, 32, 33, 34, 35, 45, 46, 47, 48, 49, 50, 52, 54, 56, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 97, 98], "nice": 75, "ninja": 47, "nitro": [27, 61], "no_tmpdir": 1, "noaux": 29, "nocloud": 86, "node": [1, 6, 12, 20, 23, 25, 26, 30, 60, 75, 94, 95], "nograph": 29, "nomodeset": 93, "nomux": 29, "non": [1, 6, 32, 46, 51, 60, 62, 67, 83, 97], "none": [1, 2, 4, 6, 7, 9, 10, 11, 12, 13, 14, 15, 16, 18, 19, 20, 21, 22, 23, 24, 25, 26, 30, 54, 60, 61, 86], "nonnegativeinteg": 60, "noop": 4, "nopasswd": 86, "nopnp": 29, "nor": 31, "normal": [23, 31, 36, 42, 43, 46, 51, 60, 61, 91, 92], "notabl": 77, "note": [1, 6, 20, 21, 23, 26, 33, 34, 36, 46, 47, 49, 54, 60, 63, 65, 71, 77, 78, 89, 91], "noth": [6, 12, 14, 15, 21, 22, 30, 51], "notif": 77, "notifi": 60, "notrunc": 30, "notset": 38, "now": [1, 29, 32, 45, 56, 60, 69, 77, 79, 87, 93, 94, 95, 96], "nproc": 54, "number": [1, 4, 6, 12, 14, 15, 20, 22, 23, 25, 28, 33, 34, 38, 39, 41, 43, 52, 54, 60, 61, 68, 76, 77, 80, 82, 94, 95, 98], "number_of_process": 54, "number_of_thread": 58, "numer": [2, 33, 38, 53, 60], "numvcpu": 33, "nutshel": 21, "nvqf": 67, "o": [1, 16, 33, 34, 46, 49, 51, 52, 57, 60, 62, 64, 69, 84, 96], "oasi": 57, "ob": [1, 28, 30, 32, 33, 34, 38, 41, 49, 60, 67, 68, 69, 73, 78, 79], "object": [1, 2, 4, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26], "obs_project": 77, "obsject": 9, "obsrepositori": [49, 60, 77, 79], "obtain": [1, 60, 77], "occasion": 60, "occupi": 30, "occur": [1, 30, 45, 46, 52, 65], "oci": [1, 9, 23, 47, 52, 60, 61, 68], "ociconfig": 10, "oem": [1, 9, 32, 33, 37, 38, 45, 46, 47, 48, 51, 52, 60, 61, 67, 68, 72, 78, 80, 82, 83, 84, 85, 86, 87, 88, 89, 93], "oem_qcow_format": 60, "oem_vmdk_format": 60, "oemconfig": [1, 30, 33, 46, 68, 80, 84, 85, 86, 87, 88, 89], "off": [1, 29, 30, 34, 51, 54, 60, 61, 86, 93], "offer": [1, 33, 37, 46, 51, 55, 57, 60, 68, 77, 82, 84, 90, 91], "offici": [46, 63, 89], "offlin": 72, "offset": [1, 6, 23], "often": [31, 62, 65], "ofw": [1, 60], "ofw_mod": 1, "old": [15, 36, 60, 96], "older": [51, 62, 74, 77], "omit": [4, 30, 49, 54, 58, 77, 89], "omit_modul": 4, "onc": [1, 23, 33, 34, 46, 51, 54, 60, 65, 68, 86, 88, 89, 90, 91, 93, 94, 95, 96, 97, 98], "one": [1, 6, 16, 20, 21, 22, 23, 26, 28, 30, 32, 33, 38, 41, 43, 45, 46, 47, 48, 49, 51, 52, 57, 59, 60, 61, 62, 64, 67, 68, 69, 70, 71, 77, 79, 80, 81, 82, 86, 89, 93, 94, 95], "ones": [24, 47, 51, 60, 75, 77, 81], "onli": [1, 4, 6, 7, 12, 14, 16, 20, 21, 23, 26, 29, 30, 31, 32, 33, 34, 36, 39, 40, 41, 42, 43, 45, 47, 48, 49, 51, 54, 58, 59, 60, 61, 62, 65, 68, 75, 77, 79, 80, 81, 83, 84, 88, 89, 93, 94, 95, 96], "onlin": 77, "only_for": 1, "onlyrequir": [1, 47, 60], "onto": [30, 65, 90, 91, 92], "op": 60, "opal": [1, 60], "opal_mod": 1, "open": [1, 23, 33, 34, 41, 47, 49, 54, 60, 61, 62, 63, 67, 68, 73, 75, 76, 79, 89], "openpow": 60, "openssh": 89, "openssl": [53, 60], "opensus": [28, 30, 31, 32, 33, 34, 38, 41, 46, 47, 49, 51, 60, 63, 67, 68, 69, 77, 78, 83, 87, 89, 91, 92, 93], "opensuse_leap_15": [49, 60], "oper": [1, 4, 16, 18, 20, 23, 30, 36, 37, 38, 41, 42, 43, 45, 46, 51, 60, 61, 62, 63, 64, 65, 69, 75, 80, 84, 90, 93], "opportun": [60, 68, 82], "oppos": 47, "opt": [21, 47], "opt1": 93, "opt2": 93, "optim": 81, "option": [1, 2, 4, 6, 9, 12, 16, 20, 21, 23, 24, 25, 26, 30, 31, 32, 33, 34, 45, 46, 47, 49, 50, 51, 52, 53, 54, 56, 59, 60, 61, 64, 65, 67, 69, 72, 74, 77, 79, 80, 82, 83, 84, 89, 91, 95, 96], "option_str": 60, "option_typ": 1, "optionali": 1, "order": [1, 6, 13, 20, 23, 25, 33, 45, 47, 57, 60, 61, 68, 69, 77, 80, 93], "ordinari": 54, "ore": [1, 20, 60, 68, 86], "org": [28, 29, 30, 31, 34, 38, 41, 46, 49, 56, 60, 62, 63, 68, 77, 87, 91, 93], "organ": [34, 98], "organis": 34, "origin": [25, 30, 41, 43, 54, 60, 68, 80, 82], "orphan": 47, "osc": [34, 54, 77, 78, 79], "osinsid": [38, 54, 63, 68, 69], "osnam": 20, "oss": [31, 34, 68, 93], "other": [1, 4, 11, 16, 20, 21, 23, 28, 30, 31, 32, 34, 36, 45, 46, 47, 48, 51, 52, 54, 55, 57, 58, 59, 60, 61, 62, 63, 64, 65, 67, 68, 70, 71, 73, 75, 77, 80, 81, 84, 85, 86, 87, 88, 89, 93], "otherwis": [1, 12, 16, 23, 36, 41, 43, 46, 49, 51, 54, 58, 65, 77, 89], "our": [1, 23, 58, 73], "out": [1, 9, 28, 30, 31, 34, 38, 46, 52, 54, 60, 61, 63, 69, 70, 84, 93], "outfil": 55, "output": [1, 13, 14, 21, 24, 36, 38, 45, 47, 60, 61, 72, 77, 91, 96], "output_avail": 1, "outsid": [1, 17, 28, 31, 34, 57, 63, 77, 93], "ova": [33, 60], "over": [1, 23, 30, 32, 46, 51, 60, 61, 67, 77, 87, 93, 94, 95], "overal": [23, 80], "overayf": 32, "overhead": [1, 23], "overlai": [1, 6, 9, 11, 23, 28, 45, 46, 47, 51, 60, 64, 65, 77, 81, 86, 93, 95, 97], "overlaid": 32, "overlap": 60, "overlay_mount": 1, "overlayf": [20, 32, 46, 60, 93, 95], "overlayroot": [46, 60], "overlayroot_readonly_parts": 60, "overlayroot_write_partit": 60, "overrid": [12, 21, 26, 60, 96], "overridden": 49, "overview": [27, 60, 61, 62, 77, 90, 91], "overwrit": [1, 20, 21, 39, 41, 43, 45, 46, 47, 60], "overwritten": [1, 4, 14, 20, 40, 45, 65], "ovf": [21, 22, 33], "ovfmanag": 33, "ovftool": [21, 33], "ovftyp": 33, "own": [1, 23, 54, 60, 77, 82, 83, 89, 92], "owner": [1, 2, 60], "ownership": 60, "p": [23, 39, 46, 61, 80, 82, 95, 97], "pack": [45, 60, 61, 63, 64, 79], "packag": [0, 29, 30, 34, 36, 38, 39, 41, 42, 43, 44, 45, 46, 49, 50, 51, 52, 56, 59, 61, 62, 63, 64, 65, 67, 68, 69, 71, 75, 77, 78, 79, 81, 85, 86, 87, 88, 89, 91, 93, 94, 95, 96, 97, 98], "package_gpgcheck": [41, 43, 49], "package_manag": [0, 1, 16], "package_manager_nam": 14, "package_manager_output": 14, "package_matches_host_architectur": 1, "package_nam": [14, 34, 60], "package_request": 14, "package_sect": 1, "package_typ": 1, "package_vers": 34, "packagemanag": [1, 14, 23, 45, 48, 68, 79], "packagemanagerbas": [14, 23], "packagemanagerdnf4": 14, "packagemanagertemplateaptget": 17, "packagemanagerzypp": 14, "packages_sect": 1, "packages_sections_nam": 1, "packer": [22, 89], "pacman": 60, "page": [1, 23, 28, 29, 30, 31, 32, 33, 34, 46, 51, 54, 56, 60, 74, 75, 77, 78, 79, 80, 81, 82, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98], "pair": [1, 23, 28, 41, 43, 67], "panic": 29, "paragraph": 54, "parallel": [54, 77], "param": [1, 19, 23, 51, 54], "param_w_default": 54, "paramet": [1, 2, 4, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 18, 19, 20, 21, 22, 23, 24, 25, 26, 28, 30, 31, 32, 33, 34, 49, 50, 51, 54, 60, 85, 86, 87, 93, 94, 95], "parameter_count": 60, "parametr": 58, "paramt": 60, "parent": [1, 60], "pars": 1, "parser": 1, "part": [1, 4, 7, 19, 23, 24, 28, 31, 38, 39, 41, 43, 45, 46, 47, 49, 51, 54, 56, 57, 60, 61, 62, 64, 65, 67, 68, 72, 80, 82, 86, 93, 96], "part_mapp": 1, "partclon": 80, "partial": 88, "partiali": 88, "particular": 93, "particularli": [30, 72], "partid": 80, "partit": [1, 6, 7, 13, 15, 20, 23, 25, 30, 32, 33, 46, 47, 51, 52, 55, 59, 72, 75, 76, 88, 90, 91, 92, 93], "partition": [0, 1, 20], "partition_id": 15, "partition_nam": [1, 20, 82], "partition_numb": 80, "partition_typ": [1, 20, 82], "partitionerbas": 15, "partitionerdasd": 15, "partitionergpt": 15, "partitionermsdo": 15, "partuuid": 1, "partx": 1, "pass": [1, 6, 22, 23, 26, 30, 32, 33, 41, 43, 46, 47, 51, 54, 60, 93], "pass_or_filenam": [41, 43], "passphras": [1, 20, 60, 67, 88], "passwd": [53, 60], "password": [1, 7, 16, 27, 41, 43, 53, 60, 68, 86, 89], "past": [22, 33], "patch": [23, 39, 61, 71, 81], "path": [4, 6, 7, 9, 10, 11, 12, 13, 14, 16, 19, 20, 21, 23, 24, 25, 26, 29, 34, 37, 38, 41, 42, 43, 44, 46, 51, 53, 55, 57, 58, 60, 61, 68, 77, 79, 82, 86, 88, 89, 92, 93, 98], "path_list": 1, "pattern": [1, 14, 18, 23, 25, 26, 47, 56, 60, 61], "patterntyp": [47, 60], "pc": [1, 68, 96], "pc98": 96, "pci": 29, "peopl": [75, 88], "pep8": 54, "per": [1, 26, 60, 61, 80, 86], "percent": 1, "perform": [1, 23, 24, 30, 41, 42, 43, 45, 46, 47, 49, 51, 54, 58, 67, 71, 75, 83, 93], "period": 54, "perm": 60, "perman": [23, 51, 75], "permiss": [1, 23, 60, 64, 77, 89], "persist": [1, 16, 32, 46, 50, 60, 84], "persistency_typ": [12, 26], "persistent_filesystem": 1, "person": 29, "perspect": 80, "phase": [1, 14, 16, 23, 41, 43, 45, 51, 60, 79], "phone": 86, "physic": [1, 30, 62, 64], "pi": 62, "pick": [23, 45, 46, 68, 77], "pickl": [1, 23], "pid": 1, "piec": 80, "pii": 29, "pilot": 60, "pinch_system": 23, "ping": 79, "pip": [54, 56, 63, 69], "pipe": 23, "pjjj": 67, "pkg_gpgcheck": 16, "place": [6, 14, 16, 23, 46, 47, 59, 60, 63, 68, 69, 77, 82, 93], "placehold": [28, 39, 60, 61, 63, 96], "plain": [6, 23, 53, 60], "plan": [23, 67], "platform": [1, 60, 61], "pleas": [6, 20, 29, 54, 60, 62, 63, 69], "please_work": 22, "plethora": 60, "plu": [9, 16, 26, 30, 31, 45, 60, 61, 65], "plug": [90, 91], "plugin": [1, 18, 54, 57, 58, 62, 63, 67, 68, 71, 73, 74, 89], "plus_packag": [1, 23], "plusrecommend": [47, 60], "plymouth": [23, 46, 60], "pocket": [60, 61], "podman": [28, 52, 58, 60, 68], "poetri": 54, "point": [1, 12, 23, 26, 30, 41, 43, 46, 49, 50, 51, 56, 60, 72, 77, 90, 98], "pointer": [1, 60], "pointless": 75, "polici": [60, 75], "poll": 1, "poll_and_watch": 1, "poll_show_progress": 1, "pool": [1, 18], "popd": 47, "popen": 1, "popul": [20, 45, 47, 51, 81, 93], "popular": 64, "port": [28, 29, 60, 96], "portabl": [23, 32], "posit": [1, 14, 22, 28], "posix": 1, "possibl": [1, 23, 29, 30, 31, 32, 33, 41, 45, 46, 48, 49, 51, 55, 60, 61, 62, 68, 69, 70, 71, 72, 81, 82, 83, 84, 87, 92, 93], "post": [4, 6, 7, 11, 12, 14, 15, 16, 21, 26, 62], "post_bootstrap": [23, 36, 45, 51], "post_init": [4, 6, 7, 11, 12, 14, 15, 16, 21, 26], "post_process_delete_request": 14, "post_process_install_requests_bootstrap": 14, "postfix": 23, "potenti": [47, 80], "power": [30, 86], "powerpc": 60, "powervm": 33, "ppc": [1, 60], "ppc64": [1, 60, 71], "ppc64le": 62, "practic": [70, 98], "pre": [1, 46, 47, 60, 62, 64, 67, 81, 89, 91, 92], "pre_disk_sync": [23, 51], "prebuilt": 79, "precalcul": [12, 20], "preced": [23, 51, 60], "precis": 46, "precondit": 1, "predecessor": 31, "predefin": [38, 46, 47], "prefer": [1, 21, 29, 31, 32, 33, 41, 43, 48, 51, 61, 63, 68, 77, 79, 82, 83, 89], "preferences_matches_host_architectur": 1, "preferlvm": 83, "prefix": [1, 6, 54, 96], "preliminari": 60, "prep": [1, 20, 82], "prepar": [1, 4, 24, 35, 38, 41, 42, 44, 46, 47, 51, 54, 64, 65], "prerequisit": 45, "presenc": 1, "present": [1, 12, 20, 21, 22, 23, 25, 30, 31, 33, 45, 46, 47, 48, 49, 52, 57, 58, 60, 65, 77, 80, 93], "preserv": [1, 23, 68], "preserve_hostnam": 86, "preserve_owner_group": 23, "press": [91, 92], "prevent": [46, 51, 77], "previou": [23, 24, 34, 40, 41, 54, 65], "previous": [9, 19, 30, 42, 44], "primari": [1, 19, 32, 45, 53, 60, 65], "primarili": 60, "print": [22, 23, 36, 38, 51, 54, 56, 57, 60, 72], "print_result": 23, "print_sensit": 23, "prio": 16, "prior": [1, 6, 23, 26, 51, 60, 63, 93], "prioriti": [1, 16, 36, 41, 43, 49, 60], "privat": [1, 54, 60, 62, 98], "prj": 77, "prjconf": [34, 77], "probabl": [63, 77, 80], "problem": [1, 18, 60, 67, 74, 75], "problemat": 71, "proc": 1, "proce": [34, 45, 63], "procedur": [1, 33, 37, 60, 65, 67, 69, 75, 79, 90, 91, 92], "process": [1, 9, 10, 14, 20, 23, 24, 29, 30, 31, 32, 34, 36, 38, 47, 51, 54, 56, 57, 60, 61, 62, 64, 65, 67, 73, 75, 77, 79, 81, 82, 84, 88, 89, 91, 92, 93, 94, 95, 98], "process_delete_request": 14, "process_install_request": 14, "process_install_requests_bootstrap": 14, "process_only_requir": 14, "process_plus_recommend": 14, "processor": 36, "prod": 51, "produc": [60, 61], "product": [1, 14, 33, 51, 59, 76], "product_iso_fil": 98, "product_request": 14, "profil": [1, 4, 29, 36, 38, 39, 45, 47, 49, 55, 59, 61, 64, 72, 76, 77, 89, 93, 97], "profile_1": 78, "profile_2": 78, "profile_a": 60, "profile_b": 60, "profile_fil": 97, "profile_matches_host_architectur": 1, "profile_nam": [23, 60, 78], "program": [1, 13, 38, 46, 47, 60, 81, 93], "program1": 47, "program2": 47, "progress": 1, "project": [1, 13, 23, 34, 46, 49, 54, 56, 60, 63, 67, 73, 79], "project_fil": 1, "prompt": [46, 65, 96], "proper": 60, "properli": [1, 46, 47, 60, 74, 75], "properti": [1, 26, 29], "protect": [1, 20, 29, 60, 75], "protected_map_id": 20, "protocol": [1, 9, 25, 32, 41, 60, 94, 95, 96], "provid": [1, 2, 4, 6, 12, 14, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 33, 34, 35, 36, 38, 39, 41, 43, 45, 46, 47, 48, 49, 50, 52, 53, 54, 55, 56, 57, 60, 61, 62, 63, 64, 65, 66, 67, 68, 71, 73, 74, 75, 76, 77, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98], "provided_data_sector": 60, "provis": 60, "proxi": [29, 96], "proxycommand": 29, "pt": 51, "ptable_entry_typ": [1, 20], "ptuuid": 1, "pub": 54, "public": [1, 54, 62, 67, 89, 98], "publicli": [23, 67], "publish": [1, 34, 60], "pull": [52, 54, 58], "puppet": 47, "purpos": [1, 16, 23, 48, 51, 60, 61, 68, 74, 77, 79, 82, 84, 95], "push": [54, 68], "pushd": 47, "put": [22, 54, 60, 68, 77, 82], "pv": 26, "pvgrub": 33, "pvscsi": 33, "pwdformat": [53, 60], "pxe": [9, 30, 31, 32, 38, 46, 52, 60, 61, 62, 65, 76, 94, 95, 96], "pxe_serv": 30, "pxe_server_ip": 30, "pxeboot": [30, 93], "pxelinux": [30, 93, 94, 95, 96], "py": [7, 13, 56, 58], "pygrub": 33, "pypi": 63, "pytest": [54, 58], "python": [1, 2, 23, 36, 38, 52, 56, 61, 62, 63, 64, 85], "python3": [50, 63, 67, 68], "q": 54, "qcow2": [33, 45, 48, 60, 61, 72], "qemu": [21, 29, 30, 31, 32, 33, 45, 48, 52, 60, 61, 64, 67, 68, 69, 72, 84, 93, 94, 95], "quadruple_token": 24, "qualifi": [1, 6, 60], "quantiti": 60, "question": [72, 84], "queue": 14, "quick": 62, "quickli": 52, "quit": 72, "quot": [6, 23, 54, 93], "quota": [60, 83], "quote_key_value_fil": 23, "quote_titl": 6, "r_ok": 1, "race": 58, "raid": [1, 20, 46, 60, 80, 82], "raid1": [46, 93], "raid_level": 20, "raid_root": 9, "raiddevic": [9, 20], "rais": [1, 9, 12, 13, 14, 16, 18, 19, 20, 21, 23, 26], "raise_on_busi": 1, "raise_on_command_not_found": 1, "raise_on_error": 1, "raise_on_not_found": 23, "ram": [29, 30, 32, 33, 46, 60, 84, 95], "ram1": [84, 93], "ram2": 93, "ramdisk": [30, 32, 60, 76, 93], "ramdisk_s": 84, "ramonli": 60, "rand": 23, "random": [1, 12, 20, 23, 29, 60], "rang": [1, 23, 41, 43, 75, 96], "rare": 60, "raspberri": 62, "rather": 79, "raw": [1, 9, 21, 30, 31, 33, 61, 68, 69, 84], "rawhid": [29, 62, 63], "rc_lang": 60, "rd": [30, 32, 46, 60, 84, 94, 95], "rdinit": 29, "re": [1, 43, 45, 46, 80, 96], "reach": [69, 91], "reachabl": 23, "read": [1, 6, 7, 23, 25, 26, 45, 51, 55, 57, 58, 60, 65, 75, 81, 94, 95], "readabl": [20, 23, 60, 62, 64, 88], "readi": [29, 32, 57, 62, 64], "readonli": [6, 20, 26, 32, 46, 60, 80, 82], "readwrit": 32, "real": [12, 21, 61, 64, 84], "realli": [11, 90], "realnam": 60, "realpath": 1, "reason": [1, 31, 41, 43, 51, 54, 60, 61, 68, 79, 80, 82, 94, 95], "rebase_to_root": 1, "reboot": [14, 29, 30, 32, 46, 60, 65, 75], "reboot_imag": 93, "rebuild": [4, 30, 72, 77, 93], "receiv": [26, 93], "recent": [63, 64], "recogn": 13, "recommend": [14, 18, 30, 41, 43, 45, 46, 47, 51, 52, 53, 54, 57, 60, 63, 64, 71, 73, 89, 92, 93], "reconfig_system": 97, "record": [1, 7], "recoveri": [1, 23, 30, 80], "recreat": 4, "recurs": 1, "recvoeri": 23, "red": [38, 60], "redefin": 60, "redhat": [47, 60], "redirect": [1, 93], "reduc": [1, 60, 67], "refer": [1, 13, 20, 23, 25, 30, 31, 33, 34, 41, 43, 46, 54, 57, 58, 60, 61, 63, 83, 84, 85, 86, 87, 89, 90, 91, 92, 93, 94, 95], "referenc": [4, 51, 60, 79, 80, 82, 88, 89, 93, 96], "reformat": 54, "refresh": 44, "regard": [12, 26, 64, 71], "regist": [1, 21, 46, 62, 67, 68, 85, 86, 87], "registr": 56, "registri": [60, 68], "regular": [45, 47], "rel": [1, 19, 45, 49, 60, 89], "relat": [14, 60], "relaunch": 72, "relax": 56, "relax_justdoit": 56, "relaxjustdoittask": 56, "relaxng": [1, 36], "releas": [1, 41, 43, 47, 51, 61, 62, 63], "release_identifi": 61, "release_result": 61, "release_vers": 14, "relev": [1, 2, 4, 21, 29, 32, 39, 60, 72, 77, 80, 83], "reli": [45, 47, 51, 63, 73], "reload_config": 93, "reload_imag": 93, "remain": [31, 47, 53, 60, 89], "remot": [23, 38, 41, 46, 54, 60, 67, 68, 94, 95], "remov": [1, 16, 23, 32, 44, 45, 51, 60, 77, 89], "remove_hierarchi": 1, "repart": [1, 30, 46, 60], "repartit": 46, "repeat": 94, "replac": [1, 4, 28, 30, 34, 60, 61, 77, 96], "repo": [1, 14, 16, 18, 19, 28, 29, 30, 31, 32, 33, 34, 36, 38, 41, 43, 49, 55, 60, 63, 67, 68, 69, 78, 93, 98], "repo_alia": [1, 55], "repo_fil": [16, 49], "repo_gpgcheck": [1, 16, 41, 43], "repo_imageinclud": 1, "repo_package_gpgcheck": 1, "repo_path": 19, "repo_prio": [1, 55], "repo_signing_kei": 1, "repo_sourc": [1, 19, 55], "repo_typ": [1, 16, 23, 55], "repolist": 49, "report": [1, 18, 51, 52, 60, 74], "repositori": [0, 1, 14, 18, 23, 24, 28, 34, 36, 38, 41, 42, 43, 44, 45, 47, 55, 59, 64, 65, 68, 69, 78, 79, 89, 98], "repository_gpgcheck": [49, 60], "repository_matches_host_architectur": 1, "repository_nam": 77, "repositorybas": [14, 16], "repositorydnf4": 16, "repositoryzypp": 16, "repostori": 16, "repotyp": 77, "repres": [1, 20, 30, 47, 53, 59, 60, 61, 64, 65, 80, 81, 82, 83, 93], "represent": [1, 20, 23, 24, 30, 41, 43, 47, 49], "reproduc": 77, "request": [1, 6, 12, 14, 20, 21, 25, 26, 30, 36, 38, 42, 45, 47, 54, 56, 60, 67, 74, 80, 88, 93], "request_collect": 14, "request_packag": 14, "request_package_exclus": 14, "request_package_lock": 14, "request_product": 14, "requested_filesystem": 23, "requir": [1, 4, 6, 7, 9, 11, 12, 14, 18, 20, 21, 22, 23, 26, 29, 30, 31, 33, 34, 36, 45, 46, 47, 48, 51, 56, 60, 61, 62, 63, 65, 68, 71, 73, 74, 77, 79, 80, 81, 83, 85, 86, 87, 89, 93, 94, 95, 96, 98], "reread": 1, "reserv": [60, 80, 82, 93], "reset": [1, 46, 54, 60, 80], "resid": [1, 49], "resiz": [1, 15, 21, 26, 30, 33, 35, 46, 60, 61, 68, 72, 80, 82, 85, 86, 87, 88, 89], "resize2f": 72, "resize_on_boot": 26, "resize_raw_disk": 21, "resize_t": 15, "resizef": 86, "resizepart": 72, "resolut": [1, 6, 23, 47, 60], "resolv": [1, 36, 57, 73, 77, 79], "resolve_this_path": 1, "resourc": [1, 34, 60, 68, 77, 98], "respect": [45, 60, 63], "respons": [1, 23, 34, 55, 60, 63, 68, 98], "rest": [1, 26, 93], "restart": 92, "restor": 51, "restrict": [60, 75], "restructuredtext": 54, "result": [1, 4, 9, 12, 14, 18, 19, 21, 22, 24, 29, 30, 31, 32, 33, 35, 36, 37, 38, 41, 42, 43, 47, 49, 52, 58, 60, 64, 68, 69, 71, 72, 77, 79, 80, 83, 84, 89, 93], "result_fil": 23, "result_file_typ": 23, "result_inst": 9, "result_name_tag": [1, 23], "result_typ": 23, "resultbundletask": 24, "resultlisttask": 24, "resutl": 61, "ret": 54, "retain": 30, "retri": 30, "retriev": [1, 19, 25], "return": [1, 4, 6, 7, 8, 9, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 36, 46, 54, 56, 60], "returncod": [1, 14], "reus": 55, "review": 54, "revoc": 60, "revok": 90, "rf": 68, "rhel": [18, 47], "right": [51, 54, 56, 60, 61, 63], "riot": 54, "risk": [51, 81], "rm": [28, 51, 58, 68], "rnc": 57, "rng": 57, "ro": [20, 60, 93], "robust": [30, 80], "rollback": 80, "roo": 20, "room": 62, "root": [1, 4, 6, 7, 9, 10, 11, 12, 14, 16, 20, 21, 23, 24, 26, 27, 29, 30, 31, 32, 34, 37, 38, 41, 42, 43, 44, 45, 46, 47, 51, 52, 53, 57, 58, 60, 61, 64, 65, 67, 68, 72, 76, 77, 79, 80, 81, 82, 83, 84, 86, 88, 91, 92, 94, 96, 97, 98], "root_bind": [14, 16], "root_clon": [20, 60, 80], "root_devic": [6, 7], "root_dir": [1, 4, 6, 7, 9, 10, 11, 12, 14, 16, 20, 21, 23, 26], "root_export": 93, "root_hash": 60, "root_path": 1, "root_uuid": 6, "rootbind": [14, 16, 23], "rootdelai": 85, "rootf": [1, 23, 46, 60, 68, 72, 79, 81, 82, 93], "rootflag": 60, "rootfs_label": 60, "rootinit": 23, "rootless": 58, "rootlv": 83, "routin": 62, "rpm": [1, 14, 16, 19, 23, 39, 41, 43, 47, 49, 55, 61, 62, 63, 67, 68, 77, 79], "rpm_dir": 19, "rpm_md": 19, "rpmbuild": 54, "rpmlint": 54, "rsa": [54, 67], "rsa4096": 54, "rst": 54, "rsync": [1, 21, 25, 60, 68, 89], "rsyslog": 86, "rtype": [1, 54], "rubi": 21, "rule": [1, 34, 36, 54, 56, 60, 75, 93], "run": [1, 6, 7, 16, 18, 20, 23, 24, 28, 29, 30, 32, 33, 34, 36, 37, 38, 45, 46, 47, 49, 51, 58, 60, 61, 62, 63, 64, 65, 67, 71, 72, 73, 75, 76, 77, 78, 83, 86, 89, 93, 96, 97], "run_check": 24, "run_common_funct": 23, "run_expect": 58, "run_repo_custom": 16, "runtim": [1, 14, 16, 24, 28, 38, 45, 46, 49, 54, 60, 79], "runtime_config": 16, "runtime_dnf_config": 16, "runtime_dnf_config_fil": 16, "runtime_zypp_config_fil": 16, "runtime_zypper_config": 16, "runtime_zypper_config_fil": 16, "runtimecheck": 1, "runtimeconfig": 1, "rw": [23, 31, 51, 60, 93], "rxmmeasdc035ex": [53, 68], "s390": [1, 6, 60, 62, 71], "s390x": [60, 71], "safe": 47, "safeti": 58, "salt": [53, 60], "same": [1, 9, 14, 16, 21, 23, 25, 26, 29, 30, 32, 33, 38, 39, 40, 41, 43, 45, 46, 47, 48, 49, 51, 60, 61, 67, 68, 73, 74, 77, 79, 90, 93, 94, 95], "saniti": [46, 80], "sat": [1, 19], "satisfi": 77, "satsolv": 19, "save": [29, 30, 31, 32, 57, 77], "sbin": [29, 46], "sc": 54, "scan": [1, 32, 84, 91, 92], "schedul": 1, "schema": [1, 21, 36, 49, 60, 61, 62, 65, 82], "schematron": [1, 36], "schemavers": [29, 32, 33, 47, 48, 49, 53, 60, 68, 77, 78, 79, 83, 89], "scheme": [23, 54], "scope": [6, 14, 23, 38, 46, 55, 60, 61, 84, 94], "scp": [30, 93], "scratch": [21, 28, 77], "screen": [1, 38, 51, 77], "script": [1, 16, 22, 23, 28, 36, 38, 45, 47, 49, 54, 60, 62, 64, 65, 72, 74, 77, 81, 86, 92], "script_exist": 23, "script_path": 16, "scsci": 33, "scsi": [33, 60], "sd": 62, "sda": [46, 93], "sda2": 93, "sdb": 93, "sdk": [33, 87], "sdz1": 91, "search": [1, 13, 23, 24, 37, 50, 60, 77, 79], "search_param": 60, "second": [1, 6, 25, 38, 45, 60, 64, 77, 93, 96], "secret": [16, 19], "secret_set": 22, "section": [1, 23, 30, 33, 34, 41, 43, 45, 46, 47, 51, 54, 60, 61, 65, 77, 82, 97], "section_nam": 1, "section_typ": 1, "sector": [1, 15, 20, 60, 80], "sector_s": 60, "secur": [1, 7, 20, 23, 29, 51, 60, 62, 63, 67, 70, 73, 88], "secure_boot_instal": 7, "securelinux": 1, "security_context_fil": 23, "see": [1, 23, 25, 28, 30, 31, 32, 33, 34, 41, 43, 45, 47, 48, 49, 51, 53, 54, 56, 58, 60, 61, 64, 65, 67, 68, 69, 77, 78, 82, 85, 86, 87, 89, 93, 94, 95], "seek": 1, "select": [1, 23, 30, 36, 38, 41, 43, 45, 46, 47, 49, 52, 58, 59, 60, 61, 62, 64, 68, 69, 77, 78, 90, 91, 92, 93], "self": [7, 45, 54, 56, 66, 73, 74, 75], "selfcontain": 67, "selinux": [23, 60, 75], "selinux_polici": 60, "semant": 54, "semicolon": [41, 43], "send": [1, 38, 93], "sens": 60, "sensit": 29, "sent": [1, 28, 36, 54], "separ": [1, 4, 24, 30, 33, 46, 48, 51, 53, 60, 64, 67, 77, 83, 93], "sequenc": [1, 38, 60, 62, 68, 82, 89], "sequenti": 77, "serial": [1, 8, 30, 31, 32, 60, 69, 84, 85, 87], "serial_lin": 60, "serial_line_setup": 60, "serializ": 21, "seriou": 75, "serv": [1, 30, 46, 60, 79, 84, 93, 96], "server": [1, 9, 30, 47, 60, 76, 77, 94, 95], "servernam": 96, "servic": [1, 11, 23, 34, 36, 37, 38, 39, 40, 41, 42, 43, 44, 46, 47, 49, 51, 54, 56, 60, 62, 63, 64, 67, 68, 73, 75, 76, 79, 86, 88, 89, 96], "service_command": 56, "service_nam": 51, "servicenam": 51, "session": [38, 51], "set": [1, 4, 11, 12, 13, 15, 20, 21, 22, 23, 25, 26, 28, 29, 30, 31, 32, 34, 38, 39, 41, 43, 45, 46, 47, 48, 50, 51, 52, 54, 56, 58, 60, 61, 65, 67, 68, 69, 70, 76, 77, 78, 80, 82, 83, 85, 86, 87, 88, 89, 92, 93, 94, 95], "set_color_format": 1, "set_container_config_tag": 1, "set_custom_runtime_config_fil": 1, "set_derived_from_image_uri": 1, "set_disk_password": 7, "set_dist_typ": 18, "set_flag": 15, "set_hostnam": 86, "set_hybrid_mbr": 15, "set_loader_entri": 6, "set_log_socket": 1, "set_logfil": 1, "set_mbr": 15, "set_media_tag": 13, "set_platform_nam": 1, "set_property_readonly_root": [12, 26], "set_repositori": 1, "set_root_filesystem_uuid": 1, "set_root_partition_uuid": 1, "set_runtime_checker_metadata": 1, "set_selinux_file_context": 23, "set_shared_cache_loc": 1, "set_start_sector": [15, 20], "set_static_modul": 4, "set_temp_loc": 1, "set_uuid": [12, 15], "setenforc": 75, "setlogflag": 1, "setloglevel": 1, "setup": [0, 1, 4, 6, 7, 14, 15, 16, 21, 22, 24, 26, 29, 30, 31, 32, 33, 36, 38, 41, 43, 44, 45, 46, 47, 51, 52, 54, 55, 56, 60, 67, 74, 76, 77, 79, 80, 81, 83, 84, 85, 86, 87, 88, 89, 91, 92, 94, 95, 96, 97], "setup_disk_boot_imag": 6, "setup_disk_image_config": 6, "setup_group": 23, "setup_home_for_us": 23, "setup_install_boot_imag": 6, "setup_install_image_config": 6, "setup_intermediate_config": 23, "setup_keyboard_map": 23, "setup_live_boot_imag": 6, "setup_live_image_config": 6, "setup_load": 6, "setup_local": 23, "setup_machine_id": 23, "setup_media_loader_directori": 13, "setup_mountpoint": 26, "setup_package_database_configur": 16, "setup_permiss": 23, "setup_plymouth_splash": 23, "setup_registry_import": 23, "setup_repositori": 23, "setup_repository_modul": 14, "setup_root_consol": 11, "setup_selinux_file_context": 23, "setup_sysconfig_bootload": 6, "setup_timezon": 23, "setup_us": 23, "setuptool": 56, "setvar": 96, "sever": [33, 49, 51, 52, 60, 65, 73, 75, 82], "sfdisk": 15, "sh": [23, 28, 29, 36, 45, 46, 47, 58, 65, 74, 77, 89, 97], "sha": [24, 39], "sha256": [25, 60], "shadow": 47, "share": [1, 16, 21, 23, 38, 41, 43, 51, 57, 58, 60, 62, 77, 89], "shared_dnf_dir": 16, "shared_loc": [16, 23], "shared_zypper_dir": 16, "shasum": [23, 36], "shebang": 51, "sheet": 1, "shell": [1, 36, 45, 46, 51, 54, 60, 63, 65, 67, 86], "shim": [1, 7, 47, 60, 68], "shim_loader_typ": 1, "shiminstal": 60, "shimopt": 60, "ship": [47, 63, 89, 93], "short": [1, 50, 60, 84], "shorten": 47, "should": [1, 6, 11, 12, 20, 23, 24, 26, 31, 41, 48, 49, 51, 54, 59, 60, 67, 68, 71, 77, 80, 81, 82, 83, 84, 88, 89, 93], "should_perform_task_setup": 24, "show": [1, 30, 33, 34, 38, 46, 51, 55, 56, 60, 62, 67, 77, 90, 91, 92, 93, 98], "show_and_exit_on_help_request": 1, "shown": [1, 25, 29, 30, 31, 32, 33, 46, 47, 51, 60, 71, 80, 82, 94, 95], "shrink": [1, 21], "shutdown": 30, "side": [46, 73, 94, 95], "sig": 28, "sigkil": 28, "sign": [1, 4, 9, 34, 41, 42, 43, 60], "sign_key_a": 60, "sign_key_b": 60, "signal": [1, 28], "signatur": [1, 16, 34, 41, 42, 43, 49], "significantli": 60, "signing_kei": [4, 9, 16, 23, 41, 43], "signingkei": 54, "signkei": 54, "sigterm": [1, 28], "silent": 30, "similar": [14, 30, 36, 57, 65, 67, 75, 93], "similarli": 47, "simpl": [1, 9, 22, 33, 52, 55, 60, 69, 80, 84], "simpler": 77, "simplest": 79, "simpli": [1, 21, 60, 68], "simplifi": [51, 77], "simul": 64, "sinc": [2, 7, 21, 45, 54, 60, 63, 65, 77, 89, 93], "singl": [1, 20, 38, 41, 45, 46, 47, 55, 58, 60, 77], "situat": [46, 47, 70], "size": [1, 12, 15, 20, 21, 22, 26, 30, 36, 37, 46, 54, 74, 80, 82, 83, 84, 85, 86, 87, 89, 93], "size_byt": 21, "size_limit": 23, "size_str": 82, "size_typ": 1, "skip": [7, 14, 18, 23, 30, 60, 84], "skip_miss": 18, "skopeo": 28, "slash": 25, "sle": [47, 51, 63, 98], "sle12": 51, "sled": 60, "slot": 62, "small": [38, 60, 62], "smaller": [1, 23, 30, 47, 60, 80, 82], "smoother": 77, "smp": 72, "snapper": [1, 60], "snapshot": [6, 26, 32, 60, 68, 72, 77], "snip": [29, 32, 33, 47, 49, 78], "snippet": 89, "so": [13, 15, 23, 31, 38, 45, 51, 55, 58, 60, 63, 64, 65, 72, 74, 77, 78, 89, 93], "soc": 62, "socat": 29, "socket": [1, 29, 38, 51], "socketfil": 38, "softwar": [23, 30, 38, 45, 60, 62, 64, 65, 68, 80, 85, 86, 87, 88, 91, 93], "solut": [38, 70], "solv": [1, 18, 36, 74, 75, 77], "solvabl": [1, 16, 18, 19], "solver": [0, 1], "solver_repositori": 18, "solverrepositori": [18, 19], "solverrepositorybas": 19, "solverrepositoryrpmdir": 19, "solverrepositoryrpmmd": 19, "solverrepositorysus": 19, "some": [1, 2, 6, 10, 11, 20, 23, 41, 43, 51, 52, 60, 61, 63, 68, 71, 79, 82, 83, 89, 96], "some1": 60, "some2": 60, "some_data": 25, "somepackag": 77, "somepackage_1": 77, "somepackage_2": 77, "somepakage_1": 77, "someth": 1, "soon": 93, "sort": [1, 26, 61, 62], "sort_by_hierarchi": 1, "sourc": [1, 2, 4, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 30, 36, 38, 41, 43, 47, 49, 51, 54, 58, 62, 65, 68, 77, 79, 80, 89, 92, 93, 98], "source_dir": [2, 13, 23, 25], "source_fil": 25, "source_filenam": 25, "source_provid": 20, "source_typ": 23, "sourcetyp": [16, 60], "space": [1, 20, 26, 30, 33, 37, 41, 43, 46, 60, 64, 72, 80, 82, 83, 84, 89, 93, 96], "spare": [1, 20, 60, 82], "spare_part": [1, 60, 82], "spare_part_f": 60, "spare_part_fs_attribut": 60, "spare_part_is_last": 60, "spare_part_mountpoint": 60, "spars": [21, 74], "spec": [20, 54, 60], "specfi": 1, "special": [1, 4, 6, 7, 11, 12, 13, 14, 15, 16, 19, 20, 21, 22, 23, 25, 26, 38, 46, 47, 49, 54, 60, 83], "specif": [1, 4, 6, 9, 14, 20, 21, 23, 26, 30, 32, 33, 36, 41, 43, 46, 47, 50, 51, 52, 53, 59, 60, 61, 62, 63, 64, 65, 68, 78, 79, 80, 81, 82, 83, 84, 89, 93, 98], "specifi": [1, 6, 9, 12, 19, 20, 21, 23, 24, 25, 26, 28, 29, 30, 31, 32, 34, 36, 37, 38, 39, 41, 42, 43, 44, 45, 46, 47, 49, 51, 53, 57, 58, 59, 60, 61, 62, 64, 77, 80, 82, 83, 84, 89, 93, 94, 95], "speed": [1, 30, 58, 60], "sphinx": 54, "splash": 23, "split": [1, 60], "squashf": [1, 20, 32, 46, 60, 61, 82, 93], "squashfscompress": 60, "squashimg": 46, "src": [47, 93], "srv": [30, 93, 94, 95, 96], "srvip": 93, "ssh": [29, 51, 67, 86, 89], "ssh_svcname": 86, "sshd": [51, 67, 86], "sshf": 67, "ssz": 60, "stabl": [67, 77], "stack": 68, "stackabl": 68, "stackbuild": 68, "stage": [36, 38, 45, 47, 88], "stai": [1, 30, 60, 98], "stand": [34, 68], "standalon": 60, "standalone_integr": 60, "standard": [1, 6, 11, 13, 20, 28, 30, 32, 33, 38, 45, 46, 49, 54, 56, 57, 60, 61, 62, 67, 68, 69, 78, 84], "start": [1, 11, 14, 15, 16, 20, 34, 38, 46, 51, 57, 60, 62, 64, 65, 77, 80, 87, 96, 97, 98], "start_sector": [15, 20], "startup": [34, 56], "state": [1, 4, 23, 60, 61, 80, 86], "stateless": 51, "statement": [1, 59, 60, 77], "static": [1, 4, 7, 9, 10, 11, 12, 13, 14, 15, 16, 19, 20, 21, 22, 23, 26, 36, 60, 77], "staticlink": 77, "staticmethod": 54, "statu": [1, 14, 20, 32, 61, 71], "std": 29, "stderr": 1, "stderr_to_stdout": 1, "stdin": 51, "stdio": [30, 31, 32, 69, 84], "stdout": [1, 38, 55], "step": [21, 23, 24, 30, 38, 41, 42, 43, 46, 47, 51, 60, 62, 63, 64, 65, 68, 72, 75, 78, 79, 89, 92, 94, 95, 96, 98], "stick": [9, 30, 32, 46, 54, 60, 61, 62, 76, 84, 87, 92], "stickdevic": 90, "still": [1, 31, 47, 51, 71, 84, 89], "stop": [45, 46], "stopsign": 28, "storag": [0, 1, 26, 30, 32, 55, 60, 61, 62, 80, 84, 90, 91, 92, 94, 95], "storage_provid": [15, 20], "storagemap": 9, "store": [1, 4, 6, 7, 12, 14, 16, 18, 19, 21, 23, 25, 26, 30, 33, 38, 39, 41, 42, 46, 60, 64, 68, 88, 97], "store_to_result": 21, "str": [1, 4, 6, 7, 9, 10, 11, 12, 13, 14, 15, 16, 19, 20, 21, 22, 23, 24, 25, 26, 54], "strategi": [30, 31, 60, 61, 93], "stream": [1, 14, 60], "streamoptim": 33, "string": [1, 2, 4, 6, 7, 9, 10, 11, 12, 15, 18, 19, 20, 21, 22, 23, 24, 25, 26, 30, 33, 34, 39, 41, 43, 51, 60, 82], "strip": [1, 22], "stripe": [1, 20, 60], "strongli": [77, 92], "structur": [1, 6, 20, 25, 54, 57, 59, 60, 64, 93, 96, 98], "stuff": 57, "style": [1, 15, 25, 60], "stylesheet": [36, 60], "sub": [1, 14, 26, 48, 52, 60], "subclass": [4, 14, 23], "subcommand": [1, 28, 57], "subdir": 96, "subdirectori": [46, 64, 77], "subfold": [54, 77], "subformat": 0, "subject": 77, "submenu": 92, "submit": 54, "subprocess": 1, "subproject": 67, "subscrib": 62, "subsect": [1, 33, 65], "subsequ": 60, "subset": 26, "substep": 45, "substitut": [1, 22, 69], "substr": [1, 61], "substract": 84, "subsystem": [34, 52, 60, 61, 75], "subvol": 60, "subvol_mount_list": 26, "subvolum": [1, 26, 60, 83], "succe": 56, "success": [1, 14, 23, 61, 72, 77, 81], "successfulli": 69, "sudo": [28, 29, 30, 31, 32, 33, 34, 38, 51, 63, 67, 68, 69, 75, 78, 84, 86, 89, 91, 93, 94, 95, 98], "sudoer": 51, "suffici": [45, 60, 89], "suffix": [25, 30, 58, 69, 83], "suggest": [70, 87], "suit": 89, "suitabl": [4, 9, 21, 26, 29, 54, 60, 61, 67, 84, 93], "sum": [23, 24, 30, 80, 93], "superblock": 60, "supplement": 64, "supplementari": [53, 60], "suppli": [1, 21, 28, 32, 51, 60], "support": [1, 2, 4, 6, 7, 8, 9, 12, 14, 15, 16, 20, 21, 23, 25, 26, 29, 30, 32, 33, 34, 38, 41, 43, 45, 46, 47, 50, 51, 52, 53, 54, 57, 60, 61, 62, 63, 64, 65, 67, 68, 71, 73, 78, 79, 80, 81, 82, 83, 84, 88, 89, 91, 92, 93, 94, 95], "supported_zipp": [25, 54], "suppos": 19, "sure": [16, 20, 24, 25, 28, 30, 34, 68, 72, 74, 84, 85, 86, 87, 88, 90, 92, 93, 96], "suse": [1, 18, 19, 33, 34, 41, 46, 47, 51, 60, 68, 76, 77, 85, 86, 87, 88, 93, 97], "suseinsertservic": 51, "suseremoveservic": 51, "suseservic": 51, "susesetupproduct": 51, "susestripkernel": 23, "swap": [1, 20, 30, 82, 84, 87, 93], "swapnam": [1, 30], "swapsiz": [1, 30], "swapspac": 30, "swiss": 62, "switch": [1, 51, 60, 84, 93], "sy": [1, 55], "symbol": 77, "symlink": [23, 51], "sync": [1, 12, 23, 26, 39, 51], "sync_data": [12, 25, 26, 55], "synchron": [51, 60, 89, 93], "synchronis": 1, "synopsi": 78, "syntax": [50, 54, 61], "syscal": 28, "sysconfig": [6, 23, 51, 97], "sysconfig_firsboot": 97, "sysconfig_templ": 97, "syslinux": [91, 96], "syslog_fix_perm": 86, "system": [0, 1, 4, 6, 9, 10, 11, 14, 16, 20, 24, 27, 28, 29, 30, 32, 33, 34, 35, 38, 45, 46, 51, 52, 53, 55, 57, 58, 59, 60, 61, 63, 65, 67, 68, 69, 71, 72, 73, 75, 76, 78, 79, 80, 81, 82, 83, 86, 87, 89, 91, 92, 94, 95, 96, 97], "system_boot": 9, "system_custom_part": 9, "system_efi": 9, "system_info": 86, "system_root_volum": [6, 7], "system_spar": 9, "system_volum": [6, 7], "systembuildtask": 24, "systemcreatetask": 24, "systemctl": [51, 96], "systemd": [6, 7, 11, 20, 23, 46, 51, 60, 79, 83, 87, 88], "systemd_boot": 60, "systemdep": [52, 54], "systemdisk": [1, 30, 83], "systemid": 57, "systemidentifi": [4, 6, 23], "systemprepar": 23, "systempreparetask": 24, "systems": [1, 23, 30, 80, 82], "systemsetup": 23, "systemupdatetask": 24, "systemvg": 26, "sysv": 51, "t": [1, 14, 21, 23, 25, 26, 39, 54, 60, 61, 63, 67, 69, 72, 74, 77, 81, 82, 96], "tab": [67, 77], "tabl": [1, 13, 15, 20, 28, 51, 52, 60, 71, 80, 82, 90, 92, 93], "table_entri": 20, "table_typ": [15, 20], "tag": [1, 13, 21, 28, 41, 43, 60], "tagger": 1, "tagnam": 60, "take": [1, 7, 21, 23, 30, 46, 47, 54, 60, 61, 68, 69, 80, 81, 87, 93], "taken": [1, 6, 16, 20, 21, 26, 34, 46, 51, 60, 61, 64, 68, 75, 77, 80, 98], "tar": [1, 9, 10, 21, 23, 28, 30, 45, 47, 52, 60, 61, 64, 65, 79, 89], "tarbal": [9, 21, 23, 28, 30, 34, 45, 60, 61, 65, 79], "tarfil": 2, "target": [1, 2, 4, 6, 9, 12, 19, 20, 21, 23, 24, 25, 28, 29, 30, 31, 32, 33, 34, 37, 38, 39, 40, 41, 42, 45, 46, 51, 52, 54, 60, 61, 62, 64, 65, 67, 68, 69, 71, 72, 73, 74, 76, 78, 79, 81, 84, 93, 94, 95], "target_arch": [4, 23], "target_blocks": 60, "target_devic": 20, "target_dir": [1, 4, 9, 19, 21, 23, 25, 60], "target_disk": 30, "target_remov": [7, 60], "target_root_dir": 23, "target_st": 1, "target_supports_extended_attribut": 25, "target_typ": 1, "targettyp": 60, "task": [0, 1, 4, 23, 26, 46, 51, 54, 55, 56, 57, 58, 65, 79, 87, 94], "tbz": [9, 52, 60, 61, 79], "tc": 57, "team": [34, 67], "technologi": [29, 32, 60, 61, 62, 64, 67, 89], "tell": [11, 21, 60, 93, 94, 97], "temp": [1, 38], "temp_image_dir": 21, "templat": [0, 1, 6, 9, 54, 60, 86, 93, 97], "templates_dir": 86, "temporari": [1, 4, 6, 21, 23, 25, 30, 38, 41, 45, 60, 75], "temporarli": 23, "tend": [62, 63], "tentuple_token": 24, "term": 46, "termin": [8, 38, 46, 51], "terminal_setup": 60, "terminologi": 31, "test": [1, 27, 28, 29, 30, 31, 32, 33, 38, 51, 56, 57, 60, 61, 62, 63, 67, 68, 69, 72, 77, 78, 84, 89, 93, 94, 95], "test_rmwork": 58, "testinfra": 58, "testing_": 77, "testing_x86": 46, "text": [1, 6, 19, 23, 34, 38, 39, 53, 54, 57, 60, 61, 96], "tftp": [30, 93], "tftp_root_dir": 96, "tftpboot": [30, 93, 94, 95, 96], "tgz": [47, 65], "than": [1, 6, 26, 30, 36, 46, 49, 52, 60, 62, 67, 73, 74, 79, 80, 82], "thank": 54, "thei": [1, 16, 30, 45, 46, 47, 49, 51, 54, 55, 57, 60, 61, 62, 67, 68, 79, 82, 89, 94], "them": [1, 20, 22, 28, 33, 45, 47, 49, 54, 59, 60, 62, 63, 67, 68, 73, 77, 79, 80, 92, 98], "theme": [6, 23], "themselv": [52, 65, 83], "therebi": 77, "therefor": [1, 6, 19, 21, 36, 47, 55, 59, 60, 68, 77, 79, 84, 88, 91, 92, 98], "therfor": 45, "thi": [0, 1, 4, 6, 7, 9, 11, 12, 13, 14, 16, 18, 19, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 51, 52, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 75, 76, 77, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98], "thing": [63, 93], "third": 93, "this_is_soo_insecur": 53, "those": [1, 23, 38, 51, 54, 60, 67, 73, 77, 82, 93, 94], "though": [60, 77, 79], "three": [31, 60, 61, 81], "through": [20, 29, 32, 36, 45, 46, 49, 51, 52, 60, 62, 67, 75, 77, 81, 84, 87, 91, 92, 94, 96, 98], "throughout": 51, "throw": 23, "thrown": 1, "thu": [1, 4, 6, 7, 11, 12, 23, 26, 30, 38, 47, 54, 56, 60, 67, 71, 74, 77, 80, 81, 84, 87, 93], "ti": 82, "tie": 59, "tightli": 60, "time": [1, 6, 9, 11, 12, 19, 20, 23, 24, 26, 30, 33, 38, 40, 41, 42, 43, 44, 46, 47, 50, 54, 56, 59, 60, 61, 67, 68, 70, 74, 80, 81, 82, 86, 90, 91, 92, 94], "timeout": [1, 6, 33, 60, 84, 85, 86, 87, 89, 96], "timeout_styl": [1, 60], "timestamp": 19, "timezon": [23, 51, 65, 68, 86], "titl": [6, 30, 57, 60, 77], "tmp": [10, 19, 28, 29, 30, 31, 32, 33, 34, 38, 55, 60, 67, 68, 69, 78, 93], "tmpf": [1, 46, 60, 93], "tmpfs_mount": 1, "to_profil": 1, "todai": [23, 29, 60, 80], "togeth": [1, 36, 47, 59, 60, 68, 71, 81, 87], "toggl": 60, "token": 19, "told": 72, "too": [16, 20, 26, 46, 47, 60, 64, 77, 93], "tool": [1, 13, 23, 25, 28, 32, 33, 45, 46, 47, 51, 52, 54, 60, 71, 73, 74, 82, 85, 86, 89, 91], "tool_categori": 1, "toolchain": [52, 60, 68, 93], "toolkit": [52, 94], "top": [45, 47, 49, 54, 59, 60, 64, 68, 78, 88], "top_level_entry_profil": 36, "topic": [1, 28, 29, 30, 32, 33, 54, 89], "toplevel": [1, 6, 26, 57, 59, 60], "toplevel_mount": 26, "toplevel_nam": 60, "torito": 1, "total": [1, 33], "touch": [1, 6, 46, 58, 97], "tox": [54, 58], "tpm": 60, "trace": 23, "track": [45, 61], "tradit": 82, "trang": 57, "transact": [18, 96], "transform": [1, 68], "translat": [23, 41, 49, 51, 60], "transpar": 1, "transport": 10, "treat": [1, 14, 60], "tree": [1, 4, 9, 12, 23, 28, 38, 41, 44, 45, 46, 51, 60, 61, 63, 64, 65, 67, 68, 69, 79, 81, 98], "trigger": [9, 23, 31, 32, 51, 60, 83], "trim": 1, "troubl": 69, "troubleshoot": [62, 69, 75], "true": [1, 2, 4, 6, 7, 8, 9, 10, 13, 14, 18, 19, 20, 21, 22, 23, 24, 25, 26, 29, 30, 31, 32, 33, 41, 43, 46, 49, 51, 54, 56, 58, 60, 61, 80, 83, 84, 85, 86, 87, 88, 89], "truncat": 23, "trust": [16, 41, 42, 43, 60, 67], "trust_cpu": 29, "trustworthi": 88, "try": [1, 54, 87], "ttys0": [29, 85, 87], "tumblewe": [31, 34, 46, 58, 62, 63, 68, 77, 93, 95], "tumbleweed_appli": [32, 33], "tune": [45, 65], "tupl": [1, 4, 20, 23, 26], "turn": [15, 20, 54, 60, 61], "tutori": 77, "tux": 10, "tw": 54, "tweak": [70, 71], "twmo": 68, "two": [33, 38, 45, 47, 48, 49, 51, 60, 63, 64, 67, 68, 77, 80, 87, 94, 95], "twogbmaxextentflat": 33, "twogbmaxextentspars": 33, "type": [1, 4, 6, 7, 8, 9, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 29, 30, 31, 32, 33, 34, 36, 38, 39, 41, 42, 43, 45, 46, 47, 48, 49, 51, 52, 54, 59, 62, 65, 67, 68, 72, 74, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 92, 93, 96, 97], "type_identifi": 82, "type_nam": 15, "typecod": 15, "typeddict": [9, 10], "typenam": 60, "typic": [1, 34, 60, 61, 62, 94], "u": [34, 54, 60, 68, 73], "uapi": 1, "ubuntu": [33, 62, 72, 73], "ubuntu64guest": 33, "ud": 1, "udev": 47, "uebn": 67, "uefi": [46, 60, 68, 80, 90, 91, 96], "uh4cgjlkcrabjtjzdek9kvl": 67, "uid": [28, 54], "ultim": 54, "umoci": [1, 28], "umount": [1, 12, 23, 26, 51, 94], "umount_kernel_file_system": 23, "umount_lazi": 1, "umount_volum": [12, 26], "un": 12, "unam": [1, 47, 60], "unattend": [30, 46, 84], "unauthor": 75, "unchang": [30, 60, 75], "uncompress": [1, 2, 21, 24, 25, 39, 60], "uncompressed_filenam": 25, "uncondition": [41, 43], "under": [2, 31, 34, 37, 41, 51, 55, 56, 58, 60, 73, 89], "underlai": [20, 26], "underli": [1, 38, 47], "understand": [46, 60, 61], "understood": 60, "unencrypt": 88, "unexpect": 1, "unfortun": 77, "unicod": 1, "unifi": 20, "uniniti": [23, 51], "uninstal": [1, 23, 45, 60], "union": [1, 93], "unionfs_config": 93, "unionfs_configur": 93, "uniqu": [1, 41, 43, 51, 57, 60, 80, 82], "unit": [1, 12, 23, 33, 46, 51, 60, 80, 82, 85, 86, 87, 89], "unit_py3_11": 54, "unit_typ": 1, "univers": 31, "unix": [1, 30, 38, 53, 60, 90, 91], "unknown": [1, 23, 54, 81], "unless": [1, 14, 20, 51, 54, 60], "unlock": 20, "unmount": [1, 26], "unpack": [23, 30, 45, 51, 60, 64, 65, 79], "unpackag": 45, "unpartit": [1, 9, 33, 46, 80, 82], "unplug": 84, "unpredict": [60, 77], "unreason": 52, "unresolv": [60, 77], "unsaf": 1, "unsign": [1, 28], "unspecifi": 1, "unstabl": 30, "unsuit": 50, "unsupport": 1, "until": [1, 60], "untouch": [1, 34, 91, 92], "unus": [4, 6, 7, 11, 12, 13, 14, 15, 16, 21, 26, 33], "unwant": [16, 21, 45, 46, 82], "up": [1, 6, 11, 19, 23, 30, 43, 45, 46, 47, 54, 56, 57, 60, 63, 64, 65, 72, 76, 77, 89, 93, 94, 95], "updat": [4, 6, 9, 14, 23, 24, 30, 35, 36, 51, 54, 60, 62, 63, 67, 76, 77, 80, 85, 86, 87, 88, 89, 97], "update_etc_host": 86, "update_hostnam": 86, "update_system": 23, "upgrad": [1, 24, 62, 86], "upload": [77, 85, 86, 87], "upon": 65, "uppercas": 96, "upstream": [32, 60, 72, 73, 91, 92], "uri": [1, 16, 19, 30, 41, 43, 46, 57, 60], "uri_list": 23, "uri_typ": 43, "url": [1, 23, 30, 41, 43, 49, 60, 63, 77], "urllib": 1, "urlopen": 1, "urn": 57, "us": [1, 2, 4, 6, 9, 10, 12, 13, 14, 16, 18, 19, 20, 21, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 41, 42, 43, 44, 45, 46, 47, 48, 49, 51, 52, 53, 54, 56, 58, 59, 60, 61, 63, 64, 65, 67, 68, 69, 71, 72, 73, 74, 76, 78, 79, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97], "usabl": [32, 68, 77], "usag": [1, 22, 45, 48, 56, 60, 89], "usb": [30, 32, 46, 60, 61, 62, 76, 84, 92], "use_default_loc": 16, "use_for_bootstrap": 60, "use_for_bundl": 23, "user": [1, 10, 16, 19, 21, 28, 30, 41, 43, 45, 47, 49, 52, 54, 55, 58, 63, 64, 65, 67, 68, 75, 77, 82, 86, 89, 90, 91, 93, 95, 96, 98], "user_add": 23, "user_credenti": 1, "user_exist": 23, "user_modifi": 23, "user_nam": [1, 23], "useradd": 23, "usermod": 23, "usernam": [16, 53, 54, 60], "userspac": 60, "usr": [1, 46, 47, 57, 60, 62, 83], "usrmerg": 79, "usual": [1, 9, 18, 36, 45, 46, 51, 54, 60, 64, 65, 68, 77, 79, 81, 84, 89, 91, 96, 98], "utc": 68, "utf": [1, 60, 68, 77, 78, 89], "utf8": 23, "util": [0, 34, 54, 58, 60, 62, 72, 79, 96, 97], "uuid": [1, 6, 12, 15, 20, 25, 26, 30, 31, 46, 51, 60, 80, 82, 85], "uuid4": [23, 41, 43, 49], "uwp": 34, "v": [23, 38, 39, 60, 61, 70, 73, 85], "v2": 2, "v247": 23, "v249": 51, "v74": 62, "v9": 60, "vagrant": [1, 21, 22, 33, 51, 60, 62, 76, 77, 78], "vagrant_post_init": 21, "vagrantconfig": [1, 21, 89], "vagrantconfigtempl": [21, 22], "vagrantfil": [21, 22], "vagrantup": 21, "valid": [1, 16, 23, 24, 32, 33, 34, 36, 40, 41, 42, 43, 49, 51, 52, 54, 57, 60, 65, 67, 68, 81, 83], "valu": [1, 10, 12, 19, 20, 21, 22, 23, 24, 28, 30, 32, 33, 36, 37, 38, 41, 43, 46, 47, 49, 51, 60, 61, 75, 80, 82, 83, 84, 88, 93], "valueerror": 1, "var": [1, 10, 19, 38, 51, 60, 79, 82, 86, 97], "vari": [6, 65], "variabl": [1, 21, 22, 23, 28, 30, 36, 46, 54, 58, 60], "variant": [23, 25, 58, 81], "variat": 60, "varieti": 93, "variou": [23, 34, 61, 62], "vblade": [93, 94, 95], "vboxf": 89, "vboxsf": 89, "vcehlsns1d50wnfoaiprgddy04omiaj8": 67, "vda3": 72, "vdi": [33, 60], "vendor": [1, 30, 73, 89, 98], "veri": [54, 60, 75, 77, 80, 90], "verif": [1, 12, 23, 26, 30, 32, 60, 61, 84], "verifi": [1, 13, 23, 30, 33, 49, 58, 60, 61, 84, 89], "verification_metadata_signing_key_fil": 1, "verify_image_s": 23, "veriti": 60, "verity_block": 60, "veritysetup": [12, 26, 60], "version": [14, 23, 33, 34, 35, 38, 39, 41, 43, 48, 51, 55, 57, 59, 61, 62, 63, 64, 65, 66, 68, 69, 73, 74, 77, 78, 79, 89, 93, 94, 95], "vesa": [1, 6], "vgroup": 83, "vh4vw1n4alxkq": 89, "vhd": [33, 60, 85], "vhdfixedtag": 60, "vhdx": [33, 60], "vhost4": 29, "vi": [29, 46, 68, 93, 95], "via": [1, 9, 12, 21, 22, 23, 26, 29, 30, 32, 33, 34, 38, 41, 43, 45, 47, 48, 49, 50, 51, 53, 54, 58, 60, 61, 62, 63, 69, 77, 78, 79, 80, 81, 82, 83, 89, 93, 94, 95, 96], "video": 1, "video_typ": 1, "vim": [33, 54], "virtio": [31, 33, 67, 69], "virtiof": 67, "virtual": [21, 22, 27, 28, 30, 34, 38, 45, 46, 48, 49, 51, 52, 56, 60, 61, 62, 63, 64, 65, 67, 68, 69, 77, 84, 85, 86, 87, 88, 89, 93, 94], "virtualbox": [21, 22, 64, 89], "virtualbox_guest_additions_pres": [1, 89], "virtualboxovftempl": [21, 22], "virtualenv": 54, "virtuals": 89, "visibl": [47, 49, 77, 80, 95], "visit": [29, 46], "vm": [22, 48, 67, 71, 72, 89], "vm_descript": 22, "vm_name": 22, "vmconfig": [1, 33], "vmconfig_entri": 1, "vmdisk": [1, 33], "vmdk": [33, 48, 60], "vmdvd": [1, 33], "vmnic": [1, 33], "vmware": [21, 22, 33, 48], "vmwaresettingstempl": 22, "vmx": 33, "volid": [41, 43, 60], "volum": [1, 6, 7, 9, 10, 12, 26, 28, 30, 60, 76, 82], "volume_group": 26, "volume_group_nam": 26, "volume_label": 1, "volume_manag": 0, "volume_manager_inst": 6, "volume_map": 26, "volume_matches_host_architectur": 1, "volume_nam": 1, "volume_par": 1, "volume_s": 1, "volume_typ": [1, 26], "volumemanag": [12, 26], "volumemanagerbas": [9, 26], "volumemanagerbtrf": 26, "volumemanagerlvm": 26, "vsock": 29, "vtoc": 20, "w_ok": 1, "wa": [1, 16, 22, 26, 31, 43, 45, 56, 59, 67, 72, 79, 84, 90, 91, 94, 95], "wai": [1, 23, 26, 31, 32, 36, 41, 43, 45, 49, 51, 54, 55, 60, 61, 62, 63, 72, 73, 75, 77, 79, 81, 82, 89, 93, 97], "wait": [1, 30], "want": [1, 21, 47, 54, 55, 56, 60, 63, 67, 72, 75, 78, 89], "warn": [1, 23, 38], "warningfilt": 1, "wast": [1, 20], "we": [1, 6, 14, 20, 21, 23, 27, 30, 41, 43, 47, 54, 56, 57, 60, 61, 64, 67, 69, 71, 72, 73, 74, 77, 87, 89, 93], "web": [1, 60, 62, 77], "welcom": 67, "well": [1, 20, 30, 31, 32, 46, 52, 57, 60, 62, 64, 67, 71, 77, 84], "were": [1, 51, 59, 61, 68, 81, 87], "what": [23, 54, 60, 97], "whatev": 60, "when": [1, 16, 21, 23, 28, 30, 31, 32, 33, 34, 36, 41, 45, 46, 47, 48, 51, 53, 54, 60, 61, 63, 64, 67, 68, 71, 72, 74, 75, 77, 79, 80, 81, 82, 83, 87, 88, 89, 93, 96, 98], "whenev": 51, "where": [1, 33, 47, 49, 54, 59, 61, 67, 72, 77, 79, 81, 84, 93], "wherea": [32, 54], "whether": [1, 30, 32, 33, 34, 47, 48, 49, 51, 54, 55, 60, 63, 80, 89, 92], "which": [1, 4, 6, 9, 11, 12, 14, 16, 18, 20, 21, 23, 24, 26, 28, 29, 30, 31, 33, 36, 41, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 59, 60, 61, 62, 63, 65, 66, 67, 68, 69, 70, 71, 73, 74, 75, 76, 77, 79, 80, 81, 82, 83, 84, 85, 86, 87, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98], "whichev": 54, "while": [1, 20, 30, 32, 41, 43, 46, 51, 60, 72], "who": [63, 75], "whole": 60, "whose": [18, 47, 80], "whther": 31, "why": [60, 68], "wide": [23, 75], "width": 54, "wiki": [30, 93], "wikibook": [30, 93], "window": [1, 34, 52, 60, 61, 91, 92], "wipe": [1, 20], "wire": 89, "wise": [1, 60, 82], "wish": [60, 69], "with_timeout": 8, "within": [1, 29, 33, 60, 61, 64, 65, 72, 76, 87, 94, 95, 96], "without": [1, 22, 23, 30, 45, 46, 47, 49, 60, 61, 65, 67, 68, 77, 78, 79, 80, 82, 84, 89, 90, 92], "won": 63, "word": [60, 61], "work": [15, 20, 23, 28, 33, 38, 41, 42, 43, 45, 47, 51, 54, 60, 61, 62, 63, 67, 68, 69, 71, 73, 75, 82, 84, 89, 90, 92, 96], "workaround": 77, "workdir": 28, "worker": [1, 34], "workflow": [30, 33, 46, 62, 64], "working_directori": 23, "working_with_kiwi": 54, "workingdir": [10, 28], "workload": 1, "worksheet": 76, "world": 68, "worth": 71, "would": [1, 21, 54, 60, 61, 71, 75, 77, 79, 80, 81, 84, 87, 92], "wrapper": 13, "writabl": [32, 51, 60], "write": [1, 4, 6, 12, 23, 25, 26, 32, 38, 41, 46, 51, 54, 60, 75, 80, 83, 86, 93, 95], "write_devic": 6, "write_meta_data": 6, "write_system_config_fil": 4, "write_to_disk": 23, "written": [32, 46, 54, 56, 58, 60, 96, 97], "wrong": 1, "wrongli": 81, "wsl": [1, 27, 52, 60, 61], "wto": 33, "www": [21, 33, 57], "wyjugpm5": [53, 68], "x": [10, 12, 54, 93], "x11": 89, "x86": [1, 28, 29, 30, 31, 32, 33, 34, 38, 47, 60, 62, 67, 68, 69, 71, 77, 78, 93, 95, 96], "x86_64": [1, 28, 29, 30, 32, 33, 47, 61, 68, 69, 71, 72, 77, 79, 84, 86, 90, 91, 93, 94, 95], "x86pc": 96, "x_ok": 1, "xdist": 54, "xdm6wwzqhae": 67, "xen": [1, 6, 8, 23, 33, 60, 86], "xen_hypervisor_typ": 23, "xen_load": [1, 33, 86], "xf": [9, 30, 32, 60, 61, 68, 74, 80, 82], "xfs_info": 74, "xkb": 60, "xml": [1, 4, 20, 23, 24, 28, 29, 31, 32, 33, 34, 36, 38, 41, 43, 44, 45, 51, 52, 55, 59, 60, 62, 64, 65, 68, 77, 78, 83, 88, 89, 93, 97], "xml_": 41, "xml_data": [1, 55], "xml_descript": [55, 57], "xml_pars": [1, 21], "xml_state": [4, 6, 7, 9, 12, 20, 21, 23, 55], "xmlcatalog": 57, "xmldescript": [1, 55, 57], "xmln": 57, "xmlstate": [1, 4, 6, 7, 9, 12, 20, 21, 23, 26, 55], "xorriso": 1, "xscale_efi": 96, "xsl": 62, "xsl_to_v74": 62, "xslt": [1, 36, 60], "xsltproc": 62, "xvc0": 86, "xxx": 98, "xyz": [53, 60], "xz": [1, 2, 9, 24, 25, 28, 30, 39, 60, 61, 79], "xz_option": [2, 9], "y": 20, "yaml": [1, 36, 50, 52], "yast": 76, "yast2": 97, "ye": [51, 71], "year": 54, "yellow": 38, "yet": [1, 7, 60, 63, 67, 79], "yml": [1, 38, 50], "you": [22, 23, 28, 29, 30, 31, 32, 33, 34, 38, 40, 43, 45, 46, 47, 48, 49, 51, 54, 55, 56, 57, 58, 60, 62, 63, 64, 65, 67, 68, 72, 77, 78, 89, 92, 93, 96], "your": [20, 21, 22, 28, 29, 30, 32, 33, 34, 45, 49, 53, 54, 55, 56, 57, 58, 62, 63, 72, 74, 77, 78, 79, 80, 86, 89, 90, 91, 92, 93, 96, 97], "your_email": 54, "your_password": 53, "your_sign_key_id": 54, "yourself": 77, "ytxphhuhhgaieubuher2gzoo": 67, "z": 60, "z0": 60, "za": 60, "zap": 20, "zero": [1, 15, 51, 54], "zfcp": 60, "zip": [21, 34], "zipl": [1, 60], "zipl2grub": 6, "zone": 60, "zoneinfo": 60, "zstd": 60, "zsync": 39, "zsync_sourc": 39, "zvm": 33, "zypp": 16, "zypper": [28, 34, 45, 47, 48, 49, 60, 63, 67, 68, 94], "zypper_arg": [14, 16]}, "titles": ["Python API", "kiwi Package", "kiwi.archive Package", "kiwi.boot Package", "kiwi.boot.image Package", "kiwi.bootloader Package", "kiwi.bootloader.config Package", "kiwi.bootloader.install Package", "kiwi.bootloader.template Package", "kiwi.builder Package", "kiwi.container Package", "kiwi.container.setup Package", "kiwi.filesystem Package", "kiwi.iso_tools Package", "kiwi.package_manager Package", "kiwi.partitioner Package", "kiwi.repository Package", "kiwi.repository.template Package", "kiwi.solver Package", "kiwi.solver.repository Package", "kiwi.storage Package", "kiwi.storage.subformat Package", "kiwi.storage.subformat.template Package", "kiwi.system Package", "kiwi.tasks package", "kiwi.utils Package", "kiwi.volume_manager Package", "Building Images for Supported Types", "Build a Container Image", "Build an AWS Nitro Enclave", "Build an Expandable Disk Image", "Build KIS Image (Kernel, Initrd, System)", "Build an ISO Hybrid Live Image", "Build a Virtual Disk Image", "Build a WSL Container Image", "Working from the Command Line", "kiwi-ng image info", "kiwi-ng image resize", "kiwi-ng", "kiwi-ng result bundle", "kiwi-ng result list", "kiwi-ng system build", "kiwi-ng system create", "kiwi-ng system prepare", "kiwi-ng system update", "Concept and Workflow", "Customizing the Boot Process", "Adding and Removing Packages", "Image Profiles", "Setting up Repositories", "The Runtime Configuration File", "User-Defined Scripts", "Host Requirements To Build Images", "Adding Users", "Contributing", "Using KIWI NG in a Python Project", "Plugin Architecture", "Extending KIWI NG with Custom Operations", "Write Integration Tests for the Scripts", "Image Description", "Image Description Elements", "Image Types", "Building Linux System Appliances", "Installation", "Overview", "Basic Workflow", "KIWI Plugins", "Building in a Self-Contained Environment", "Building based on Containers", "Quick Start", "Troubleshooting", "Architectures", "Boxbuild Tweaks", "Build Host Constraints", "Incompatible Filesystem Settings on Host vs. Image", "Host Security Settings Conflicts with KIWI", "Working with Images", "Building in the Open Build Service", "Building Images with Profiles", "Circumvent Debian Bootstrap", "Partition Clones", "Add or Update the Fstab File", "Custom Disk Partitions", "Custom Disk Volumes", "Deploy and Run System in a RamDisk", "Image Description for Microsoft Azure", "Image Description for Amazon EC2", "Image Description for Google Compute Engine", "Image Description Encrypted Disk", "Image Description for Vagrant", "Deploy ISO Image on an USB Stick", "Deploy ISO Image as File on a FAT32 Formated USB Stick", "Booting a Live ISO Images from Grub2", "Build PXE Root File System Image for the legacy netboot infrastructure", "Booting a Live ISO Image from Network", "Booting a Root Filesystem from Network", "Setting Up a Network Boot Server", "Setting Up YaST at First Boot", "Using SUSE Product ISO To Build"], "titleterms": {"": 93, "The": [45, 47, 50, 54, 57, 62], "To": [52, 98], "abstract": [28, 29, 30, 31, 32, 33, 34, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98], "ad": [33, 47, 49, 53], "add": 81, "addit": 54, "advantag": 77, "after": 93, "amazon": 86, "an": [29, 30, 32, 65, 90], "api": 0, "app": 1, "applianc": [62, 63], "apt": 17, "architectur": [56, 71], "archiv": [2, 9, 47, 60], "aw": 29, "azur": 85, "backend": 67, "base": [4, 6, 7, 11, 12, 13, 14, 15, 16, 19, 21, 24, 26, 68], "basic": [54, 65], "befor": 69, "between": 77, "block": 25, "boot": [3, 4, 46, 92, 93, 94, 95, 96, 97], "bootload": [5, 6, 7, 8, 33, 60], "bootloaderset": 60, "bootsplash": 60, "bootstrap": 79, "bootstrap_packag": 79, "box": 72, "boxbuild": [67, 72], "branch": 54, "btrf": [12, 26], "bugfix": 54, "build": [27, 28, 29, 30, 31, 32, 33, 34, 41, 45, 52, 62, 67, 68, 69, 72, 73, 77, 78, 93, 98], "builder": 9, "builtin_kiwi": 4, "bump": 54, "bundl": [39, 61], "case": [62, 80], "catalog": 57, "cd": [30, 33], "check": 60, "checksum": 25, "choos": 69, "circumv": 79, "cli": 1, "client": 93, "clone": [54, 80], "clone_devic": 20, "code": 54, "collectionmodul": 60, "command": [1, 35, 67], "command_process": 1, "compon": 65, "compress": 25, "comput": 87, "concept": [45, 62, 68], "conceptu": 64, "config": [6, 51], "configur": [33, 50, 51, 77, 93, 96], "conflict": 75, "constraint": 73, "contact": 62, "contain": [9, 10, 11, 28, 34, 60, 67, 68], "containerconfig": 60, "content": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 59], "contribut": 54, "control": 33, "convent": 56, "cpio": 2, "creat": [42, 45, 54, 68, 79], "custom": [30, 33, 46, 57, 69, 82, 83, 89, 93], "dasd": 15, "debian": 79, "debug": [46, 51], "default": 1, "defin": 51, "deploi": [84, 90, 91], "deploy": [30, 93], "descript": [36, 37, 38, 39, 40, 41, 42, 43, 44, 59, 60, 63, 65, 85, 86, 87, 88, 89], "develop": [51, 54], "device_provid": 20, "dhcp": 96, "differ": [77, 93], "directli": 33, "disk": [9, 20, 30, 33, 82, 83, 88, 93], "distribut": 63, "distro": 71, "distrolaunch": 34, "dmsquash": 32, "dnf4": [14, 16], "dnsmasq": 96, "docker": 11, "document": [32, 54], "download": 93, "dracut": 4, "drive": 33, "dvd": [30, 33], "each": 54, "ec2": 86, "element": [47, 60], "embed": 89, "enclav": 29, "encrypt": 88, "engin": 87, "enterpris": 63, "environ": [51, 54, 67], "exampl": [38, 56, 63], "except": 1, "excludedoc": 60, "expand": 30, "ext2": 12, "ext3": 12, "ext4": 12, "extend": 57, "extens": 57, "fat16": 12, "fat32": [12, 91], "featur": 54, "file": [50, 60, 81, 91, 93], "filesystem": [9, 12, 74, 95], "filter": 60, "firmwar": 1, "first": [69, 97], "forc": 93, "fork": 54, "format": [61, 91], "from": [35, 63, 68, 92, 94, 95], "fstab": 81, "function": 51, "gce": 21, "git": 54, "global": 38, "googl": 87, "gpt": 15, "grub2": [6, 7, 8, 92], "help": 1, "hook": 46, "host": [52, 73, 74, 75], "how": 79, "hybrid": 32, "ident": 59, "identifi": 23, "ignor": [47, 60], "imag": [4, 27, 28, 30, 31, 32, 33, 34, 36, 37, 45, 46, 48, 51, 52, 59, 60, 61, 65, 68, 69, 72, 74, 76, 78, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94], "includ": [59, 60], "incompat": 74, "increas": 72, "info": 36, "inform": 54, "infrastructur": 93, "initrd": 31, "instal": [7, 9, 30, 54, 63, 68, 96], "installmedia": 60, "integr": 58, "interfac": 33, "iso": [13, 32, 90, 91, 92, 94, 98], "iso_tool": 13, "isof": 12, "kernel": [23, 31, 93], "keytabl": 60, "ki": [9, 31], "kiwi": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 36, 37, 38, 39, 40, 41, 42, 43, 44, 51, 55, 57, 66, 75], "legaci": 93, "line": 35, "link": 62, "linux": [62, 63], "list": 40, "live": [9, 32, 92, 94], "load": 93, "local": [54, 60, 77, 78, 93], "logger": 1, "logger_color_formatt": 1, "logger_filt": 1, "loop_devic": 20, "luks_devic": 20, "luksformat": 60, "lvm": 26, "machin": [33, 60], "main": 59, "manual": 30, "mapped_devic": 20, "md": 93, "media": 30, "method": 30, "microsoft": 85, "modifi": 33, "modul": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26], "mount_manag": 1, "msdo": 15, "name": 56, "namedcollect": [47, 60], "namespac": 59, "netboot": 93, "network": [30, 33, 94, 95, 96], "ng": [36, 37, 38, 39, 40, 41, 42, 43, 44, 51, 55, 57], "nitro": 29, "ob": [63, 77], "oci": 10, "oem": 30, "oemconfig": 60, "open": [77, 78], "oper": [54, 57], "option": [36, 37, 38, 39, 40, 41, 42, 43, 44, 93], "ova": 21, "overlai": 32, "overview": [45, 64], "packag": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 47, 54, 60], "package_manag": 14, "packagemanag": 60, "paramet": 46, "partit": [60, 80, 82], "partition": 15, "patch": 54, "path": [1, 49], "plugin": [56, 66], "prefer": [59, 60], "prepar": [23, 43, 45], "privileg": 1, "process": [45, 46], "product": [47, 60, 98], "profil": [23, 48, 51, 60, 78], "project": [55, 77], "protocol": 93, "provid": 51, "pxe": 93, "python": [0, 54, 55], "qcow2": 21, "quick": 69, "raid": 93, "raid_devic": 20, "ramdisk": 84, "reboot": 93, "rebuild": 68, "recommend": 77, "relax": 57, "releas": 60, "reload": 93, "remot": 93, "remov": 47, "repositori": [16, 17, 19, 49, 54, 60, 63, 77], "requir": [52, 54, 64, 67], "resiz": 37, "result": [23, 39, 40, 61], "result_bundl": 24, "result_list": 24, "root": [59, 93, 95], "root_bind": 23, "root_init": 23, "rpm": [54, 60], "run": [54, 69, 84], "runtim": 50, "runtime_check": 1, "runtime_config": 1, "sat": 18, "schema": 57, "script": [46, 51, 58], "section": 57, "secur": 75, "securelinux": 60, "self": 67, "server": [93, 96], "servic": [77, 78], "set": [33, 49, 74, 75, 96, 97], "setup": [11, 12, 20, 23, 34, 58, 59, 93], "sh": 51, "share": 67, "shell": 23, "sign": 54, "signatur": 60, "size": [23, 33, 60, 72], "softwar": 59, "solver": [18, 19], "sourc": [59, 60], "specifi": 33, "squashf": 12, "start": 69, "stash": 68, "step": 45, "stick": [90, 91], "storag": [20, 21, 22], "style": 54, "subformat": [21, 22], "submodul": [1, 2, 4, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26], "support": [27, 49], "suse": [63, 98], "sync": 25, "synopsi": [36, 37, 38, 39, 40, 41, 42, 43, 44], "sysconfig": 25, "system": [23, 31, 41, 42, 43, 44, 47, 54, 62, 64, 84, 93], "system_build": 24, "system_cr": 24, "system_prepar": 24, "system_upd": 24, "systemd_boot": [6, 7], "systemdisk": 60, "tar": 2, "task": 24, "templat": [8, 17, 22, 51], "terminologi": 64, "test": [34, 54, 58], "tftp": 96, "theme": 60, "timeout": 93, "timezon": 60, "tip": 51, "troubleshoot": 70, "turn": 68, "tweak": [69, 72], "type": [27, 60, 61], "uninstal": 47, "unit": 54, "up": [33, 49, 96, 97], "updat": [44, 81], "upstream": 54, "uri": 23, "uri_typ": 41, "us": [55, 57, 62, 77, 80, 98], "usb": [90, 91], "user": [23, 51, 53, 59, 60], "util": 25, "v": 74, "vagrant": 89, "vagrant_bas": 21, "vagrant_config": 22, "vagrant_libvirt": 21, "vagrant_virtualbox": 21, "vagrantconfig": 60, "vagrantfil": 89, "variabl": 51, "vdi": 21, "version": [1, 54, 60], "vhd": 21, "vhdfix": 21, "vhdx": 21, "virtual": [33, 54], "virtualbox_ovf": 22, "vm": [33, 68], "vmdk": 21, "vmware_set": 22, "volum": 83, "volume_manag": 26, "work": [35, 76, 77], "workflow": [45, 65], "write": 58, "wsl": 34, "xf": 12, "xml": 57, "xml_descript": 1, "xml_state": 1, "xorriso": 13, "yast": 97, "you": 69, "your": 69, "zipl": [6, 7], "zypper": [14, 16]}}) \ No newline at end of file +Search.setIndex({"alltitles": {"": [[60, "containers"]], "": [[60, "containers-container"]], "": [[60, "description"]], "": [[60, "image"]], "": [[60, "include"]], "": [[60, "packages"]], "": [[60, "packages-archive"]], "": [[60, "packages-collectionmodule"]], "": [[60, "packages-file"]], "": [[60, "packages-ignore"]], "": [[60, "packages-namedcollection"]], "": [[60, "packages-package"]], "": [[60, "packages-product"]], "": [[60, "preferences"]], "": [[60, "preferences-bootloader-theme"]], "": [[60, "preferences-bootsplash-theme"]], "": [[60, "preferences-keytable"]], "": [[60, "preferences-locale"]], "": [[60, "preferences-packagemanager"]], "": [[60, "preferences-release-version"]], "": [[60, "preferences-rpm-check-signatures"]], "": [[60, "preferences-rpm-excludedocs"]], "": [[60, "preferences-rpm-locale-filtering"]], "": [[60, "preferences-timezone"]], "": [[60, "preferences-type"]], "": [[60, "preferences-type-bootloader"]], "": [[60, "preferences-type-bootloader-bootloadersettings"]], "": [[60, "preferences-type-bootloader-securelinux"]], "": [[60, "preferences-type-containerconfig"]], "": [[60, "preferences-type-installmedia"]], "": [[60, "preferences-type-luksformat"]], "": [[60, "preferences-type-machine"]], "": [[60, "preferences-type-oemconfig"]], "": [[60, "preferences-type-partitions"]], "": [[60, "preferences-type-size"]], "": [[60, "preferences-type-systemdisk"]], "": [[60, "preferences-type-vagrantconfig"]], "": [[60, "preferences-version"]], "": [[60, "profiles"]], "": [[60, "repository"]], "": [[60, "repository-source"]], "": [[60, "users"]], "Abstract": [[28, null], [29, null], [30, null], [31, null], [32, null], [33, null], [34, null], [79, null], [80, null], [81, null], [82, null], [83, null], [84, null], [85, null], [86, null], [87, null], [88, null], [89, null], [90, null], [91, null], [92, null], [93, null], [94, null], [95, null], [96, null], [97, null], [98, null]], "Add or Update the Fstab File": [[81, null]], "Adding CD/DVD Drives": [[33, "adding-cd-dvd-drives"]], "Adding Network Interfaces to the VM": [[33, "adding-network-interfaces-to-the-vm"]], "Adding Users": [[53, null]], "Adding and Removing Packages": [[47, null]], "Adding repositories": [[49, "adding-repositories"]], "Additional Information": [[54, "additional-information"]], "Advantages of using the Open Build Service (OBS)": [[77, "advantages-of-using-the-open-build-service-obs"]], "Architectures": [[71, null]], "Basic Workflow": [[65, null]], "Before you start": [[69, "before-you-start"]], "Boot Debugging": [[46, "boot-debugging"]], "Boot Image Hook-Scripts": [[46, "boot-image-hook-scripts"]], "Boot Image Parameters": [[46, "boot-image-parameters"]], "Booting a Live ISO Image from Network": [[94, null]], "Booting a Live ISO Images from Grub2": [[92, null]], "Booting a Root Filesystem from Network": [[95, null]], "Boxbuild Tweaks": [[72, null]], "Build Host Constraints": [[73, null]], "Build KIS Image (Kernel, Initrd, System)": [[31, null]], "Build PXE Root File System Image for the legacy netboot infrastructure": [[93, null]], "Build a Container Image": [[28, null]], "Build a Virtual Disk Image": [[33, null]], "Build a WSL Container Image": [[34, null]], "Build an AWS Nitro Enclave": [[29, null]], "Build an Expandable Disk Image": [[30, null]], "Build an ISO Hybrid Live Image": [[32, null]], "Build your First Image": [[69, "build-your-first-image"]], "Building Images for Supported Types": [[27, null]], "Building Images with Profiles": [[78, null]], "Building Linux System Appliances": [[62, null]], "Building based on Containers": [[68, null]], "Building in a Self-Contained Environment": [[67, null]], "Building in the Open Build Service": [[77, null]], "Building with the Open Build Service": [[78, "building-with-the-open-build-service"]], "Building with the boxbuild command": [[67, "building-with-the-boxbuild-command"]], "Bumping the Version": [[54, "bumping-the-version"]], "CD/DVD Deployment": [[30, "cd-dvd-deployment"]], "Choose a First Image": [[69, "choose-a-first-image"]], "Circumvent Debian Bootstrap": [[79, null]], "Coding Style": [[54, "coding-style"]], "Components of an Image Description": [[65, "components-of-an-image-description"]], "Concept": [[68, "concept"]], "Concept and Workflow": [[45, null]], "Conceptual Overview": [[64, "conceptual-overview"]], "Configuration Tips": [[51, "configuration-tips"]], "Contact": [[62, "contact"]], "Contributing": [[54, null]], "Create a Branch for each Feature or Bugfix": [[54, "create-a-branch-for-each-feature-or-bugfix"]], "Create a Python Virtual Development Environment": [[54, "create-a-python-virtual-development-environment"]], "Create a local clone of the forked repository": [[54, "create-a-local-clone-of-the-forked-repository"]], "Create a stash": [[68, "create-a-stash"]], "Creating a RPM Package": [[54, "creating-a-rpm-package"]], "Custom Disk Partitions": [[82, null]], "Custom Disk Volumes": [[83, null]], "Customizing the Boot Process": [[46, null]], "Customizing the Virtual Machine": [[33, "customizing-the-virtual-machine"]], "Customizing the embedded Vagrantfile": [[89, "customizing-the-embedded-vagrantfile"]], "DESCRIPTION": [[36, "description"], [37, "description"], [38, "description"], [39, "description"], [40, "description"], [41, "description"], [42, "description"], [43, "description"], [44, "description"]], "Deploy ISO Image as File on a FAT32 Formated USB Stick": [[91, null]], "Deploy ISO Image on an USB Stick": [[90, null]], "Deploy and Run System in a RamDisk": [[84, null]], "Deployment Methods": [[30, "deployment-methods"]], "Developing/Debugging Scripts": [[51, "developing-debugging-scripts"]], "Differences Between Building Locally and on OBS": [[77, "differences-between-building-locally-and-on-obs"]], "Documentation": [[54, "documentation"]], "EXAMPLE": [[38, "example"]], "Example Appliance Descriptions": [[63, "example-appliance-descriptions"]], "Example plugin": [[56, "example-plugin"]], "Extending KIWI NG with Custom Operations": [[57, null]], "Extension schema in XML catalog": [[57, "extension-schema-in-xml-catalog"]], "Fork the upstream repository": [[54, "fork-the-upstream-repository"]], "Functions": [[51, "functions"]], "Functions and Variables Provided by KIWI NG": [[51, "functions-and-variables-provided-by-kiwi-ng"]], "GLOBAL OPTIONS": [[38, "global-options"]], "Host Requirements To Build Images": [[52, null]], "Host Security Settings Conflicts with KIWI": [[75, null]], "How to Create a bootstrap_package": [[79, "how-to-create-a-bootstrap-package"]], "Image Building Process": [[45, "image-building-process"]], "Image Bundle Format": [[61, "image-bundle-format"]], "Image Content Setup": [[59, "image-content-setup"]], "Image Description": [[59, null]], "Image Description Elements": [[60, null]], "Image Description Encrypted Disk": [[88, null]], "Image Description for Amazon EC2": [[86, null]], "Image Description for Google Compute Engine": [[87, null]], "Image Description for Microsoft Azure": [[85, null]], "Image Description for Vagrant": [[89, null]], "Image Identity": [[59, "image-identity"]], "Image Includes": [[59, "image-includes"]], "Image Namespace": [[59, "image-namespace"]], "Image Preferences": [[59, "image-preferences"]], "Image Profiles": [[48, null]], "Image Results": [[61, "image-results"]], "Image Software Sources": [[59, "image-software-sources"]], "Image Types": [[61, null]], "Image Users": [[59, "image-users"]], "Incompatible Filesystem Settings on Host vs. Image": [[74, null]], "Increase Box Build Image Size": [[72, "increase-box-build-image-size"]], "Install Required Operating System Packages": [[54, "install-required-operating-system-packages"]], "Installation": [[63, null], [68, "installation"]], "Installation Media Customization": [[30, "installation-media-customization"]], "Installation for SUSE Linux Enterprise": [[63, "installation-for-suse-linux-enterprise"]], "Installation from Distribution Repositories": [[63, "installation-from-distribution-repositories"]], "Installation from OBS": [[63, "installation-from-obs"]], "Installing and Configuring DHCP and TFTP with dnsmasq": [[96, "installing-and-configuring-dhcp-and-tftp-with-dnsmasq"]], "KIWI Plugins": [[66, null]], "Links": [[62, null]], "Local Builds": [[78, "local-builds"]], "Main Root": [[59, "main-root"]], "Manual Deployment": [[30, "manual-deployment"]], "Modifying the Size of the Image": [[33, "modifying-the-size-of-the-image"]], "Modifying the VM Configuration Directly": [[33, "modifying-the-vm-configuration-directly"]], "Module Contents": [[1, "module-kiwi"], [2, "module-kiwi.archive"], [3, "module-kiwi.boot"], [4, "module-kiwi.boot.image"], [5, "module-kiwi.bootloader"], [6, "module-kiwi.bootloader.config"], [7, "module-kiwi.bootloader.install"], [8, "module-kiwi.bootloader.template"], [9, "module-kiwi.builder"], [10, "module-kiwi.container"], [11, "module-kiwi.container.setup"], [12, "module-kiwi.filesystem"], [13, "module-kiwi.iso_tools"], [14, "module-kiwi.package_manager"], [15, "module-kiwi.partitioner"], [16, "module-kiwi.repository"], [17, "module-kiwi.repository.template"], [18, "module-kiwi.solver"], [19, "module-kiwi.solver.repository"], [20, "module-kiwi.storage"], [21, "module-kiwi.storage.subformat"], [23, "module-kiwi.system"], [24, "module-kiwi.tasks"], [25, "module-kiwi.utils"], [26, "module-kiwi.volume_manager"]], "Module contents": [[22, "module-kiwi.storage.subformat.template"]], "Naming conventions": [[56, "naming-conventions"]], "Network Deployment": [[30, "network-deployment"]], "OEM Customization": [[30, "oem-customization"]], "OPTIONS": [[36, "options"], [37, "options"], [39, "options"], [40, "options"], [41, "options"], [42, "options"], [43, "options"], [44, "options"]], "Overview": [[45, "overview"], [64, null]], "PXE Client Setup Configuration": [[93, "pxe-client-setup-configuration"]], "Partition Clones": [[80, null]], "Plugin Architecture": [[56, null]], "Profile Environment Variables": [[51, "profile-environment-variables"]], "Project Configuration": [[77, "project-configuration"]], "Python API": [[0, null]], "Quick Start": [[69, null]], "RELAX NG Schema for the Extension": [[57, "relax-ng-schema-for-the-extension"]], "Rebuild from a stash": [[68, "rebuild-from-a-stash"]], "Recommendations": [[77, "recommendations"]], "Repository Configuration": [[77, "repository-configuration"]], "Requirements": [[67, "requirements"]], "Run your Image": [[69, "run-your-image"]], "Running the Unit Tests": [[54, "running-the-unit-tests"]], "SYNOPSIS": [[36, "synopsis"], [37, "synopsis"], [38, "synopsis"], [39, "synopsis"], [40, "synopsis"], [41, "synopsis"], [42, "synopsis"], [43, "synopsis"], [44, "synopsis"]], "Script Template for config.sh / images.sh": [[51, "script-template-for-config-sh-images-sh"]], "Setting Up YaST at First Boot": [[97, null]], "Setting Up a Network Boot Server": [[96, null]], "Setting up Repositories": [[49, null]], "Setting up the Bootloader in the Image": [[33, "setting-up-the-bootloader-in-the-image"]], "Setup Client for Reboot After Deployment": [[93, "setup-client-for-reboot-after-deployment"]], "Setup Client to Force Reload Configuration Files": [[93, "setup-client-to-force-reload-configuration-files"]], "Setup Client to Force Reload Image": [[93, "setup-client-to-force-reload-image"]], "Setup Client with Remote Root": [[93, "setup-client-with-remote-root"]], "Setup Client with System on Local Disk": [[93, "setup-client-with-system-on-local-disk"]], "Setup Client with System on Local MD RAID Disk": [[93, "setup-client-with-system-on-local-md-raid-disk"]], "Setup Loading of Custom Configuration File(s)": [[93, "setup-loading-of-custom-configuration-file-s"]], "Setup a Custom Boot Timeout": [[93, "setup-a-custom-boot-timeout"]], "Setup a Different Download Protocol and Server": [[93, "setup-a-different-download-protocol-and-server"]], "Setup custom kernel boot options": [[93, "setup-custom-kernel-boot-options"]], "Setup of the WSL-DistroLauncher": [[34, "setup-of-the-wsl-distrolauncher"]], "Sharing Backends": [[67, "sharing-backends"]], "Signing Git Patches": [[54, "signing-git-patches"]], "Specifying Disks and Disk Controllers": [[33, "specifying-disks-and-disk-controllers"]], "Submodules": [[1, "submodules"], [2, "submodules"], [4, "submodules"], [6, "submodules"], [7, "submodules"], [8, "submodules"], [9, "submodules"], [10, "submodules"], [11, "submodules"], [12, "submodules"], [13, "submodules"], [14, "submodules"], [15, "submodules"], [16, "submodules"], [17, "submodules"], [18, "submodules"], [19, "submodules"], [20, "submodules"], [21, "submodules"], [22, "submodules"], [23, "submodules"], [24, "submodules"], [25, "submodules"], [26, "submodules"]], "Supported repository paths": [[49, "supported-repository-paths"]], "System Requirements": [[64, "system-requirements"]], "Terminology": [[64, "terminology"]], "Test setup": [[58, "test-setup"]], "Testing the WSL image": [[34, "testing-the-wsl-image"]], "The Section": [[57, "the-extension-section"]], "The Appliance Concept": [[62, "the-appliance-concept"]], "The Basics": [[54, "the-basics"]], "The Create Step": [[45, "the-create-step"]], "The Prepare Step": [[45, "the-prepare-step"]], "The Runtime Configuration File": [[50, null]], "The archive element": [[47, "the-archive-element"]], "The ignore element": [[47, "the-ignore-element"]], "The package element": [[47, "the-package-element"]], "The product and namedCollection element": [[47, "the-product-and-namedcollection-element"]], "Troubleshooting": [[70, null]], "Turn a container into a VM image": [[68, "turn-a-container-into-a-vm-image"]], "Tweak and Customize your Image": [[69, "tweak-and-customize-your-image"]], "URI_TYPES": [[41, "uri-types"]], "Uninstall System Packages": [[47, "uninstall-system-packages"]], "Use Case": [[80, "use-case"]], "Use Cases": [[62, "use-cases"]], "User-Defined Scripts": [[51, null]], "Using KIWI NG in a Python Project": [[55, null]], "Using SUSE Product ISO To Build": [[98, null]], "Using the extension": [[57, "using-the-extension"]], "Working from the Command Line": [[35, null]], "Working with Images": [[76, null]], "Working with OBS": [[77, "working-with-obs"]], "Write Integration Tests for the Scripts": [[58, null]], "distro": [[71, null]], "dmsquash documentation": [[32, null]], "kiwi Package": [[1, null]], "kiwi-ng": [[38, null]], "kiwi-ng image info": [[36, null]], "kiwi-ng image resize": [[37, null]], "kiwi-ng result bundle": [[39, null]], "kiwi-ng result list": [[40, null]], "kiwi-ng system build": [[41, null]], "kiwi-ng system create": [[42, null]], "kiwi-ng system prepare": [[43, null]], "kiwi-ng system update": [[44, null]], "kiwi.app Module": [[1, "module-kiwi.app"]], "kiwi.archive Package": [[2, null]], "kiwi.archive.cpio Module": [[2, "module-kiwi.archive.cpio"]], "kiwi.archive.tar Module": [[2, "module-kiwi.archive.tar"]], "kiwi.boot Package": [[3, null]], "kiwi.boot.image Package": [[4, null]], "kiwi.boot.image.base Module": [[4, "module-kiwi.boot.image.base"]], "kiwi.boot.image.builtin_kiwi Module": [[4, "module-kiwi.boot.image.builtin_kiwi"]], "kiwi.boot.image.dracut Module": [[4, "module-kiwi.boot.image.dracut"]], "kiwi.bootloader Package": [[5, null]], "kiwi.bootloader.config Package": [[6, null]], "kiwi.bootloader.config.base Module": [[6, "module-kiwi.bootloader.config.base"]], "kiwi.bootloader.config.grub2 Module": [[6, "module-kiwi.bootloader.config.grub2"]], "kiwi.bootloader.config.systemd_boot Module": [[6, "module-kiwi.bootloader.config.systemd_boot"]], "kiwi.bootloader.config.zipl Module": [[6, "module-kiwi.bootloader.config.zipl"]], "kiwi.bootloader.install Package": [[7, null]], "kiwi.bootloader.install.base Module": [[7, "module-kiwi.bootloader.install.base"]], "kiwi.bootloader.install.grub2 Module": [[7, "module-kiwi.bootloader.install.grub2"]], "kiwi.bootloader.install.systemd_boot Module": [[7, "module-kiwi.bootloader.install.systemd_boot"]], "kiwi.bootloader.install.zipl Module": [[7, "module-kiwi.bootloader.install.zipl"]], "kiwi.bootloader.template Package": [[8, null]], "kiwi.bootloader.template.grub2 Module": [[8, "module-kiwi.bootloader.template.grub2"]], "kiwi.builder Package": [[9, null]], "kiwi.builder.archive Module": [[9, "module-kiwi.builder.archive"]], "kiwi.builder.container Module": [[9, "module-kiwi.builder.container"]], "kiwi.builder.disk Module": [[9, "module-kiwi.builder.disk"]], "kiwi.builder.filesystem Module": [[9, "module-kiwi.builder.filesystem"]], "kiwi.builder.install Module": [[9, "module-kiwi.builder.install"]], "kiwi.builder.kis Module": [[9, "module-kiwi.builder.kis"]], "kiwi.builder.live Module": [[9, "module-kiwi.builder.live"]], "kiwi.cli Module": [[1, "module-kiwi.cli"]], "kiwi.command Module": [[1, "module-kiwi.command"]], "kiwi.command_process Module": [[1, "module-kiwi.command_process"]], "kiwi.container Package": [[10, null]], "kiwi.container.oci Module": [[10, "module-kiwi.container.oci"]], "kiwi.container.setup Package": [[11, null]], "kiwi.container.setup.base Module": [[11, "module-kiwi.container.setup.base"]], "kiwi.container.setup.docker Module": [[11, "module-kiwi.container.setup.docker"]], "kiwi.defaults Module": [[1, "module-kiwi.defaults"]], "kiwi.exceptions Module": [[1, "module-kiwi.exceptions"]], "kiwi.filesystem Package": [[12, null]], "kiwi.filesystem.base Module": [[12, "module-kiwi.filesystem.base"]], "kiwi.filesystem.btrfs Module": [[12, "module-kiwi.filesystem.btrfs"]], "kiwi.filesystem.ext2 Module": [[12, "module-kiwi.filesystem.ext2"]], "kiwi.filesystem.ext3 Module": [[12, "module-kiwi.filesystem.ext3"]], "kiwi.filesystem.ext4 Module": [[12, "module-kiwi.filesystem.ext4"]], "kiwi.filesystem.fat16 Module": [[12, "module-kiwi.filesystem.fat16"]], "kiwi.filesystem.fat32 Module": [[12, "module-kiwi.filesystem.fat32"]], "kiwi.filesystem.isofs Module": [[12, "module-kiwi.filesystem.isofs"]], "kiwi.filesystem.setup Module": [[12, "module-kiwi.filesystem.setup"]], "kiwi.filesystem.squashfs Module": [[12, "module-kiwi.filesystem.squashfs"]], "kiwi.filesystem.xfs Module": [[12, "module-kiwi.filesystem.xfs"]], "kiwi.firmware Module": [[1, "module-kiwi.firmware"]], "kiwi.help Module": [[1, "module-kiwi.help"]], "kiwi.iso_tools Package": [[13, null]], "kiwi.iso_tools.base Module": [[13, "module-kiwi.iso_tools.base"]], "kiwi.iso_tools.iso Module": [[13, "module-kiwi.iso_tools.iso"]], "kiwi.iso_tools.xorriso Module": [[13, "module-kiwi.iso_tools.xorriso"]], "kiwi.kiwi Module": [[1, "module-kiwi.kiwi"]], "kiwi.logger Module": [[1, "module-kiwi.logger"]], "kiwi.logger_color_formatter Module": [[1, "module-kiwi.logger_color_formatter"]], "kiwi.logger_filter Module": [[1, "module-kiwi.logger_filter"]], "kiwi.mount_manager Module": [[1, "module-kiwi.mount_manager"]], "kiwi.package_manager Package": [[14, null]], "kiwi.package_manager.base Module": [[14, "module-kiwi.package_manager.base"]], "kiwi.package_manager.dnf4 Module": [[14, "module-kiwi.package_manager.dnf4"]], "kiwi.package_manager.zypper Module": [[14, "module-kiwi.package_manager.zypper"]], "kiwi.partitioner Package": [[15, null]], "kiwi.partitioner.base Module": [[15, "module-kiwi.partitioner.base"]], "kiwi.partitioner.dasd Module": [[15, "module-kiwi.partitioner.dasd"]], "kiwi.partitioner.gpt Module": [[15, "module-kiwi.partitioner.gpt"]], "kiwi.partitioner.msdos Module": [[15, "module-kiwi.partitioner.msdos"]], "kiwi.path Module": [[1, "module-kiwi.path"]], "kiwi.privileges Module": [[1, "module-kiwi.privileges"]], "kiwi.repository Package": [[16, null]], "kiwi.repository.base Module": [[16, "module-kiwi.repository.base"]], "kiwi.repository.dnf4 Module": [[16, "module-kiwi.repository.dnf4"]], "kiwi.repository.template Package": [[17, null]], "kiwi.repository.template.apt Module": [[17, "module-kiwi.repository.template.apt"]], "kiwi.repository.zypper Module": [[16, "module-kiwi.repository.zypper"]], "kiwi.runtime_checker Module": [[1, "module-kiwi.runtime_checker"]], "kiwi.runtime_config Module": [[1, "module-kiwi.runtime_config"]], "kiwi.solver Package": [[18, null]], "kiwi.solver.repository Package": [[19, null]], "kiwi.solver.repository.base Module": [[19, "module-kiwi.solver.repository.base"]], "kiwi.solver.sat Module": [[18, "module-kiwi.solver.sat"]], "kiwi.storage Package": [[20, null]], "kiwi.storage.clone_device Module": [[20, "module-kiwi.storage.clone_device"]], "kiwi.storage.device_provider Module": [[20, "module-kiwi.storage.device_provider"]], "kiwi.storage.disk Module": [[20, "module-kiwi.storage.disk"]], "kiwi.storage.loop_device Module": [[20, "module-kiwi.storage.loop_device"]], "kiwi.storage.luks_device Module": [[20, "module-kiwi.storage.luks_device"]], "kiwi.storage.mapped_device Module": [[20, "module-kiwi.storage.mapped_device"]], "kiwi.storage.raid_device Module": [[20, "module-kiwi.storage.raid_device"]], "kiwi.storage.setup Module": [[20, "module-kiwi.storage.setup"]], "kiwi.storage.subformat Package": [[21, null]], "kiwi.storage.subformat.base Module": [[21, "module-kiwi.storage.subformat.base"]], "kiwi.storage.subformat.gce Module": [[21, "module-kiwi.storage.subformat.gce"]], "kiwi.storage.subformat.ova Module": [[21, "module-kiwi.storage.subformat.ova"]], "kiwi.storage.subformat.qcow2 Module": [[21, "module-kiwi.storage.subformat.qcow2"]], "kiwi.storage.subformat.template Package": [[22, null]], "kiwi.storage.subformat.template.vagrant_config Module": [[22, "module-kiwi.storage.subformat.template.vagrant_config"]], "kiwi.storage.subformat.template.virtualbox_ovf Module": [[22, "module-kiwi.storage.subformat.template.virtualbox_ovf"]], "kiwi.storage.subformat.template.vmware_settings Module": [[22, "module-kiwi.storage.subformat.template.vmware_settings"]], "kiwi.storage.subformat.vagrant_base Module": [[21, "module-kiwi.storage.subformat.vagrant_base"]], "kiwi.storage.subformat.vagrant_libvirt Module": [[21, "module-kiwi.storage.subformat.vagrant_libvirt"]], "kiwi.storage.subformat.vagrant_virtualbox Module": [[21, "module-kiwi.storage.subformat.vagrant_virtualbox"]], "kiwi.storage.subformat.vdi Module": [[21, "module-kiwi.storage.subformat.vdi"]], "kiwi.storage.subformat.vhd Module": [[21, "module-kiwi.storage.subformat.vhd"]], "kiwi.storage.subformat.vhdfixed Module": [[21, "module-kiwi.storage.subformat.vhdfixed"]], "kiwi.storage.subformat.vhdx Module": [[21, "module-kiwi.storage.subformat.vhdx"]], "kiwi.storage.subformat.vmdk Module": [[21, "module-kiwi.storage.subformat.vmdk"]], "kiwi.system Package": [[23, null]], "kiwi.system.identifier Module": [[23, "module-kiwi.system.identifier"]], "kiwi.system.kernel Module": [[23, "module-kiwi.system.kernel"]], "kiwi.system.prepare Module": [[23, "module-kiwi.system.prepare"]], "kiwi.system.profile Module": [[23, "module-kiwi.system.profile"]], "kiwi.system.result Module": [[23, "module-kiwi.system.result"]], "kiwi.system.root_bind Module": [[23, "module-kiwi.system.root_bind"]], "kiwi.system.root_init Module": [[23, "module-kiwi.system.root_init"]], "kiwi.system.setup Module": [[23, "module-kiwi.system.setup"]], "kiwi.system.shell Module": [[23, "module-kiwi.system.shell"]], "kiwi.system.size Module": [[23, "module-kiwi.system.size"]], "kiwi.system.uri Module": [[23, "module-kiwi.system.uri"]], "kiwi.system.users Module": [[23, "module-kiwi.system.users"]], "kiwi.tasks package": [[24, null]], "kiwi.tasks.base Module": [[24, "module-kiwi.tasks.base"]], "kiwi.tasks.result_bundle Module": [[24, "module-kiwi.tasks.result_bundle"]], "kiwi.tasks.result_list Module": [[24, "module-kiwi.tasks.result_list"]], "kiwi.tasks.system_build Module": [[24, "module-kiwi.tasks.system_build"]], "kiwi.tasks.system_create Module": [[24, "module-kiwi.tasks.system_create"]], "kiwi.tasks.system_prepare Module": [[24, "module-kiwi.tasks.system_prepare"]], "kiwi.tasks.system_update Module": [[24, "module-kiwi.tasks.system_update"]], "kiwi.utils Package": [[25, null]], "kiwi.utils.block Module": [[25, "module-kiwi.utils.checksum"]], "kiwi.utils.checksum Module": [[25, "module-kiwi.utils.block"]], "kiwi.utils.compress Module": [[25, "module-kiwi.utils.compress"]], "kiwi.utils.sync Module": [[25, "module-kiwi.utils.sync"]], "kiwi.utils.sysconfig Module": [[25, "module-kiwi.utils.sysconfig"]], "kiwi.version Module": [[1, "module-kiwi.version"]], "kiwi.volume_manager Package": [[26, null]], "kiwi.volume_manager.base Module": [[26, "module-kiwi.volume_manager.base"]], "kiwi.volume_manager.btrfs Module": [[26, "module-kiwi.volume_manager.btrfs"]], "kiwi.volume_manager.lvm Module": [[26, "module-kiwi.volume_manager.lvm"]], "kiwi.xml_description Module": [[1, "module-kiwi.xml_description"]], "kiwi.xml_state Module": [[1, "module-kiwi.xml_state"]], "overlay or dmsquash": [[32, "overlay-or-dmsquash"]]}, "docnames": ["api", "api/kiwi", "api/kiwi.archive", "api/kiwi.boot", "api/kiwi.boot.image", "api/kiwi.bootloader", "api/kiwi.bootloader.config", "api/kiwi.bootloader.install", "api/kiwi.bootloader.template", "api/kiwi.builder", "api/kiwi.container", "api/kiwi.container.setup", "api/kiwi.filesystem", "api/kiwi.iso_tools", "api/kiwi.package_manager", "api/kiwi.partitioner", "api/kiwi.repository", "api/kiwi.repository.template", "api/kiwi.solver", "api/kiwi.solver.repository", "api/kiwi.storage", "api/kiwi.storage.subformat", "api/kiwi.storage.subformat.template", "api/kiwi.system", "api/kiwi.tasks", "api/kiwi.utils", "api/kiwi.volume_manager", "building_images", "building_images/build_container_image", "building_images/build_enclave", "building_images/build_expandable_disk", "building_images/build_kis", "building_images/build_live_iso", "building_images/build_simple_disk", "building_images/build_wsl_container", "commands", "commands/image_info", "commands/image_resize", "commands/kiwi", "commands/result_bundle", "commands/result_list", "commands/system_build", "commands/system_create", "commands/system_prepare", "commands/system_update", "concept_and_workflow", "concept_and_workflow/customize_the_boot_process", "concept_and_workflow/packages", "concept_and_workflow/profiles", "concept_and_workflow/repository_setup", "concept_and_workflow/runtime_configuration", "concept_and_workflow/shell_scripts", "concept_and_workflow/systemdeps", "concept_and_workflow/users", "contributing", "contributing/kiwi_from_python", "contributing/kiwi_plugin_architecture", "contributing/schema_extensions", "contributing/scripts_testing", "image_description", "image_description/elements", "image_types_and_results", "index", "installation", "overview", "overview/workflow", "plugins", "plugins/self_contained", "plugins/stackbuild", "quickstart", "troubleshooting", "troubleshooting/architectures", "troubleshooting/boxbuild_tweaks", "troubleshooting/buildhost_constraints", "troubleshooting/filesystems", "troubleshooting/security", "working_with_images", "working_with_images/build_in_buildservice", "working_with_images/build_with_profiles", "working_with_images/build_without_debianbootstrap", "working_with_images/clone_partitions", "working_with_images/custom_fstab_extension", "working_with_images/custom_partitions", "working_with_images/custom_volumes", "working_with_images/disk_ramdisk_deployment", "working_with_images/disk_setup_for_azure", "working_with_images/disk_setup_for_ec2", "working_with_images/disk_setup_for_google", "working_with_images/disk_setup_for_luks", "working_with_images/disk_setup_for_vagrant", "working_with_images/iso_to_usb_stick_deployment", "working_with_images/iso_to_usb_stick_file_based_deployment", "working_with_images/iso_to_usb_stick_grub2_boot_from_iso", "working_with_images/legacy_netboot_root_filesystem", "working_with_images/network_live_iso_boot", "working_with_images/network_overlay_boot", "working_with_images/setup_network_bootserver", "working_with_images/setup_yast_on_first_boot", "working_with_images/use_suse_media"], "envversion": {"sphinx": 62, "sphinx.domains.c": 3, "sphinx.domains.changeset": 1, "sphinx.domains.citation": 1, "sphinx.domains.cpp": 9, "sphinx.domains.index": 1, "sphinx.domains.javascript": 3, "sphinx.domains.math": 2, "sphinx.domains.python": 4, "sphinx.domains.rst": 2, "sphinx.domains.std": 2, "sphinx.ext.todo": 2, "sphinx.ext.viewcode": 1}, "filenames": ["api.rst", "api/kiwi.rst", "api/kiwi.archive.rst", "api/kiwi.boot.rst", "api/kiwi.boot.image.rst", "api/kiwi.bootloader.rst", "api/kiwi.bootloader.config.rst", "api/kiwi.bootloader.install.rst", "api/kiwi.bootloader.template.rst", "api/kiwi.builder.rst", "api/kiwi.container.rst", "api/kiwi.container.setup.rst", "api/kiwi.filesystem.rst", "api/kiwi.iso_tools.rst", "api/kiwi.package_manager.rst", "api/kiwi.partitioner.rst", "api/kiwi.repository.rst", "api/kiwi.repository.template.rst", "api/kiwi.solver.rst", "api/kiwi.solver.repository.rst", "api/kiwi.storage.rst", "api/kiwi.storage.subformat.rst", "api/kiwi.storage.subformat.template.rst", "api/kiwi.system.rst", "api/kiwi.tasks.rst", "api/kiwi.utils.rst", "api/kiwi.volume_manager.rst", "building_images.rst", "building_images/build_container_image.rst", "building_images/build_enclave.rst", "building_images/build_expandable_disk.rst", "building_images/build_kis.rst", "building_images/build_live_iso.rst", "building_images/build_simple_disk.rst", "building_images/build_wsl_container.rst", "commands.rst", "commands/image_info.rst", "commands/image_resize.rst", "commands/kiwi.rst", "commands/result_bundle.rst", "commands/result_list.rst", "commands/system_build.rst", "commands/system_create.rst", "commands/system_prepare.rst", "commands/system_update.rst", "concept_and_workflow.rst", "concept_and_workflow/customize_the_boot_process.rst", "concept_and_workflow/packages.rst", "concept_and_workflow/profiles.rst", "concept_and_workflow/repository_setup.rst", "concept_and_workflow/runtime_configuration.rst", "concept_and_workflow/shell_scripts.rst", "concept_and_workflow/systemdeps.rst", "concept_and_workflow/users.rst", "contributing.rst", "contributing/kiwi_from_python.rst", "contributing/kiwi_plugin_architecture.rst", "contributing/schema_extensions.rst", "contributing/scripts_testing.rst", "image_description.rst", "image_description/elements.rst", "image_types_and_results.rst", "index.rst", "installation.rst", "overview.rst", "overview/workflow.rst", "plugins.rst", "plugins/self_contained.rst", "plugins/stackbuild.rst", "quickstart.rst", "troubleshooting.rst", "troubleshooting/architectures.rst", "troubleshooting/boxbuild_tweaks.rst", "troubleshooting/buildhost_constraints.rst", "troubleshooting/filesystems.rst", "troubleshooting/security.rst", "working_with_images.rst", "working_with_images/build_in_buildservice.rst", "working_with_images/build_with_profiles.rst", "working_with_images/build_without_debianbootstrap.rst", "working_with_images/clone_partitions.rst", "working_with_images/custom_fstab_extension.rst", "working_with_images/custom_partitions.rst", "working_with_images/custom_volumes.rst", "working_with_images/disk_ramdisk_deployment.rst", "working_with_images/disk_setup_for_azure.rst", "working_with_images/disk_setup_for_ec2.rst", "working_with_images/disk_setup_for_google.rst", "working_with_images/disk_setup_for_luks.rst", "working_with_images/disk_setup_for_vagrant.rst", "working_with_images/iso_to_usb_stick_deployment.rst", "working_with_images/iso_to_usb_stick_file_based_deployment.rst", "working_with_images/iso_to_usb_stick_grub2_boot_from_iso.rst", "working_with_images/legacy_netboot_root_filesystem.rst", "working_with_images/network_live_iso_boot.rst", "working_with_images/network_overlay_boot.rst", "working_with_images/setup_network_bootserver.rst", "working_with_images/setup_yast_on_first_boot.rst", "working_with_images/use_suse_media.rst"], "indexentries": {"a (kiwi.system.result.result_name_tags attribute)": [[23, "kiwi.system.result.result_name_tags.A", false]], "access() (kiwi.path.path static method)": [[1, "kiwi.path.Path.access", false]], "accumulate_files() (kiwi.system.size.systemsize method)": [[23, "kiwi.system.size.SystemSize.accumulate_files", false]], "accumulate_mbyte_file_sizes() (kiwi.system.size.systemsize method)": [[23, "kiwi.system.size.SystemSize.accumulate_mbyte_file_sizes", false]], "activate_boot_partition() (kiwi.storage.disk.disk method)": [[20, "kiwi.storage.disk.Disk.activate_boot_partition", false]], "add() (kiwi.system.profile.profile method)": [[23, "kiwi.system.profile.Profile.add", false]], "add() (kiwi.system.result.result method)": [[23, "kiwi.system.result.Result.add", false]], "add_bundle_format() (kiwi.system.result.result method)": [[23, "kiwi.system.result.Result.add_bundle_format", false]], "add_container_config_label() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.add_container_config_label", false]], "add_efi_loader_parameters() (kiwi.iso_tools.base.isotoolsbase method)": [[13, "kiwi.iso_tools.base.IsoToolsBase.add_efi_loader_parameters", false]], "add_efi_loader_parameters() (kiwi.iso_tools.xorriso.isotoolsxorriso method)": [[13, "kiwi.iso_tools.xorriso.IsoToolsXorrIso.add_efi_loader_parameters", false]], "add_repo() (kiwi.repository.base.repositorybase method)": [[16, "kiwi.repository.base.RepositoryBase.add_repo", false]], "add_repo() (kiwi.repository.dnf4.repositorydnf4 method)": [[16, "kiwi.repository.dnf4.RepositoryDnf4.add_repo", false]], "add_repo() (kiwi.repository.zypper.repositoryzypper method)": [[16, "kiwi.repository.zypper.RepositoryZypper.add_repo", false]], "add_repository() (kiwi.solver.sat.sat method)": [[18, "kiwi.solver.sat.Sat.add_repository", false]], "add_repository() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.add_repository", false]], "additional_names (kiwi.container.oci.ociconfig attribute)": [[10, "kiwi.container.oci.OciConfig.additional_names", false]], "additive (kiwi.xml_state.size_type attribute)": [[1, "kiwi.xml_state.size_type.additive", false]], "alias() (kiwi.system.uri.uri method)": [[23, "kiwi.system.uri.Uri.alias", false]], "app (class in kiwi.app)": [[1, "kiwi.app.App", false]], "append_files() (kiwi.archive.tar.archivetar method)": [[2, "kiwi.archive.tar.ArchiveTar.append_files", false]], "append_unpartitioned_space() (kiwi.builder.disk.diskbuilder method)": [[9, "kiwi.builder.disk.DiskBuilder.append_unpartitioned_space", false]], "apply_attributes_on_volume() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.apply_attributes_on_volume", false]], "archivebuilder (class in kiwi.builder.archive)": [[9, "kiwi.builder.archive.ArchiveBuilder", false]], "archivecpio (class in kiwi.archive.cpio)": [[2, "kiwi.archive.cpio.ArchiveCpio", false]], "archivetar (class in kiwi.archive.tar)": [[2, "kiwi.archive.tar.ArchiveTar", false]], "attr_token() (kiwi.tasks.base.clitask method)": [[24, "kiwi.tasks.base.CliTask.attr_token", false]], "attributes (kiwi.xml_state.volume_type attribute)": [[1, "kiwi.xml_state.volume_type.attributes", false]], "author (kiwi.xml_state.description_type attribute)": [[1, "kiwi.xml_state.description_type.author", false]], "backend (kiwi.xml_state.containert attribute)": [[1, "kiwi.xml_state.ContainerT.backend", false]], "binaryname (kiwi.defaults.grub_loader_type attribute)": [[1, "kiwi.defaults.grub_loader_type.binaryname", false]], "binaryname (kiwi.defaults.shim_loader_type attribute)": [[1, "kiwi.defaults.shim_loader_type.binaryname", false]], "bind_mount() (kiwi.mount_manager.mountmanager method)": [[1, "kiwi.mount_manager.MountManager.bind_mount", false]], "bios_mode() (kiwi.firmware.firmware method)": [[1, "kiwi.firmware.FirmWare.bios_mode", false]], "blockid (class in kiwi.utils.block)": [[25, "kiwi.utils.block.BlockID", false]], "boot_names_type (class in kiwi.boot.image.base)": [[4, "kiwi.boot.image.base.boot_names_type", false]], "boot_partition_size() (kiwi.storage.setup.disksetup method)": [[20, "kiwi.storage.setup.DiskSetup.boot_partition_size", false]], "bootimage (class in kiwi.boot.image)": [[4, "kiwi.boot.image.BootImage", false]], "bootimagebase (class in kiwi.boot.image.base)": [[4, "kiwi.boot.image.base.BootImageBase", false]], "bootimagedracut (class in kiwi.boot.image.dracut)": [[4, "kiwi.boot.image.dracut.BootImageDracut", false]], "bootimagekiwi (class in kiwi.boot.image.builtin_kiwi)": [[4, "kiwi.boot.image.builtin_kiwi.BootImageKiwi", false]], "bootloaderconfigbase (class in kiwi.bootloader.config.base)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase", false]], "bootloaderconfiggrub2 (class in kiwi.bootloader.config.grub2)": [[6, "kiwi.bootloader.config.grub2.BootLoaderConfigGrub2", false]], "bootloaderinstall (class in kiwi.bootloader.install)": [[7, "kiwi.bootloader.install.BootLoaderInstall", false]], "bootloaderinstallbase (class in kiwi.bootloader.install.base)": [[7, "kiwi.bootloader.install.base.BootLoaderInstallBase", false]], "bootloaderinstallgrub2 (class in kiwi.bootloader.install.grub2)": [[7, "kiwi.bootloader.install.grub2.BootLoaderInstallGrub2", false]], "bootloaderinstallsystemdboot (class in kiwi.bootloader.install.systemd_boot)": [[7, "kiwi.bootloader.install.systemd_boot.BootLoaderInstallSystemdBoot", false]], "bootloaderinstallzipl (class in kiwi.bootloader.install.zipl)": [[7, "kiwi.bootloader.install.zipl.BootLoaderInstallZipl", false]], "bootloadersystemdboot (class in kiwi.bootloader.config.systemd_boot)": [[6, "kiwi.bootloader.config.systemd_boot.BootLoaderSystemdBoot", false]], "bootloadertemplategrub2 (class in kiwi.bootloader.template.grub2)": [[8, "kiwi.bootloader.template.grub2.BootLoaderTemplateGrub2", false]], "bootloaderzipl (class in kiwi.bootloader.config.zipl)": [[6, "kiwi.bootloader.config.zipl.BootLoaderZipl", false]], "btrfs_default_volume_requested() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.btrfs_default_volume_requested", false]], "byte (kiwi.defaults.unit_type attribute)": [[1, "kiwi.defaults.unit_type.byte", false]], "calculate_id() (kiwi.system.identifier.systemidentifier method)": [[23, "kiwi.system.identifier.SystemIdentifier.calculate_id", false]], "call() (kiwi.command.command static method)": [[1, "kiwi.command.Command.call", false]], "call_config_host_overlay_script() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.call_config_host_overlay_script", false]], "call_config_overlay_script() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.call_config_overlay_script", false]], "call_config_script() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.call_config_script", false]], "call_disk_script() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.call_disk_script", false]], "call_edit_boot_config_script() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.call_edit_boot_config_script", false]], "call_edit_boot_install_script() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.call_edit_boot_install_script", false]], "call_image_script() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.call_image_script", false]], "call_post_bootstrap_script() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.call_post_bootstrap_script", false]], "call_pre_disk_script() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.call_pre_disk_script", false]], "check_appx_naming_conventions_valid() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_appx_naming_conventions_valid", false]], "check_boot_description_exists() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_boot_description_exists", false]], "check_consistent_kernel_in_boot_and_system_image() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_consistent_kernel_in_boot_and_system_image", false]], "check_container_tool_chain_installed() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_container_tool_chain_installed", false]], "check_dracut_module_for_disk_oem_in_package_list() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_dracut_module_for_disk_oem_in_package_list", false]], "check_dracut_module_for_disk_overlay_in_package_list() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_dracut_module_for_disk_overlay_in_package_list", false]], "check_dracut_module_for_live_iso_in_package_list() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_dracut_module_for_live_iso_in_package_list", false]], "check_dracut_module_for_oem_install_in_package_list() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_dracut_module_for_oem_install_in_package_list", false]], "check_dracut_module_versions_compatible_to_kiwi() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_dracut_module_versions_compatible_to_kiwi", false]], "check_efi_fat_image_has_correct_size() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_efi_fat_image_has_correct_size", false]], "check_efi_mode_for_disk_overlay_correctly_setup() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_efi_mode_for_disk_overlay_correctly_setup", false]], "check_for_root_permissions() (kiwi.privileges.privileges static method)": [[1, "kiwi.privileges.Privileges.check_for_root_permissions", false]], "check_image_include_repos_publicly_resolvable() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_image_include_repos_publicly_resolvable", false]], "check_image_type_unique() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_image_type_unique", false]], "check_image_version_provided() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_image_version_provided", false]], "check_include_references_unresolvable() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_include_references_unresolvable", false]], "check_initrd_selection_required() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_initrd_selection_required", false]], "check_luksformat_options_valid() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_luksformat_options_valid", false]], "check_mediacheck_installed() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_mediacheck_installed", false]], "check_partuuid_persistency_type_used_with_mbr() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_partuuid_persistency_type_used_with_mbr", false]], "check_repositories_configured() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_repositories_configured", false]], "check_swap_name_used_with_lvm() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_swap_name_used_with_lvm", false]], "check_target_directory_not_in_shared_cache() (kiwi.runtime_checker.runtimechecker static method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_target_directory_not_in_shared_cache", false]], "check_volume_label_used_with_lvm() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_volume_label_used_with_lvm", false]], "check_volume_setup_defines_multiple_fullsize_volumes() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_volume_setup_defines_multiple_fullsize_volumes", false]], "check_volume_setup_defines_reserved_labels() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_volume_setup_defines_reserved_labels", false]], "check_volume_setup_has_no_root_definition() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_volume_setup_has_no_root_definition", false]], "check_xen_uniquely_setup_as_server_or_guest() (kiwi.runtime_checker.runtimechecker method)": [[1, "kiwi.runtime_checker.RuntimeChecker.check_xen_uniquely_setup_as_server_or_guest", false]], "checksum (class in kiwi.utils.checksum)": [[25, "kiwi.utils.checksum.Checksum", false]], "clean_leftovers() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.clean_leftovers", false]], "clean_leftovers() (kiwi.package_manager.dnf4.packagemanagerdnf4 method)": [[14, "kiwi.package_manager.dnf4.PackageManagerDnf4.clean_leftovers", false]], "clean_leftovers() (kiwi.package_manager.zypper.packagemanagerzypper method)": [[14, "kiwi.package_manager.zypper.PackageManagerZypper.clean_leftovers", false]], "clean_package_manager_leftovers() (kiwi.system.prepare.systemprepare method)": [[23, "kiwi.system.prepare.SystemPrepare.clean_package_manager_leftovers", false]], "cleanup() (kiwi.boot.image.base.bootimagebase method)": [[4, "kiwi.boot.image.base.BootImageBase.cleanup", false]], "cleanup() (kiwi.boot.image.builtin_kiwi.bootimagekiwi method)": [[4, "kiwi.boot.image.builtin_kiwi.BootImageKiwi.cleanup", false]], "cleanup() (kiwi.repository.base.repositorybase method)": [[16, "kiwi.repository.base.RepositoryBase.cleanup", false]], "cleanup() (kiwi.repository.dnf4.repositorydnf4 method)": [[16, "kiwi.repository.dnf4.RepositoryDnf4.cleanup", false]], "cleanup() (kiwi.repository.zypper.repositoryzypper method)": [[16, "kiwi.repository.zypper.RepositoryZypper.cleanup", false]], "cleanup() (kiwi.system.root_bind.rootbind method)": [[23, "kiwi.system.root_bind.RootBind.cleanup", false]], "cleanup() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.cleanup", false]], "cleanup_requests() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.cleanup_requests", false]], "cleanup_unused_repos() (kiwi.repository.base.repositorybase method)": [[16, "kiwi.repository.base.RepositoryBase.cleanup_unused_repos", false]], "cleanup_unused_repos() (kiwi.repository.dnf4.repositorydnf4 method)": [[16, "kiwi.repository.dnf4.RepositoryDnf4.cleanup_unused_repos", false]], "cleanup_unused_repos() (kiwi.repository.zypper.repositoryzypper method)": [[16, "kiwi.repository.zypper.RepositoryZypper.cleanup_unused_repos", false]], "cli (class in kiwi.cli)": [[1, "kiwi.cli.Cli", false]], "clitask (class in kiwi.tasks.base)": [[24, "kiwi.tasks.base.CliTask", false]], "clone (kiwi.storage.disk.ptable_entry_type attribute)": [[20, "kiwi.storage.disk.ptable_entry_type.clone", false]], "clone() (kiwi.storage.clone_device.clonedevice method)": [[20, "kiwi.storage.clone_device.CloneDevice.clone", false]], "clonedevice (class in kiwi.storage.clone_device)": [[20, "kiwi.storage.clone_device.CloneDevice", false]], "collection_matches_host_architecture() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.collection_matches_host_architecture", false]], "colorformatter (class in kiwi.logger_color_formatter)": [[1, "kiwi.logger_color_formatter.ColorFormatter", false]], "colormessage (class in kiwi.logger_color_formatter)": [[1, "kiwi.logger_color_formatter.ColorMessage", false]], "command (class in kiwi.command)": [[1, "kiwi.command.Command", false]], "commandcallt (class in kiwi.command)": [[1, "kiwi.command.CommandCallT", false]], "commanditerator (class in kiwi.command_process)": [[1, "kiwi.command_process.CommandIterator", false]], "commandprocess (class in kiwi.command_process)": [[1, "kiwi.command_process.CommandProcess", false]], "commandt (class in kiwi.command)": [[1, "kiwi.command.CommandT", false]], "compress (class in kiwi.utils.compress)": [[25, "kiwi.utils.compress.Compress", false]], "compress (kiwi.system.result.result_file_type attribute)": [[23, "kiwi.system.result.result_file_type.compress", false]], "contact (kiwi.xml_state.description_type attribute)": [[1, "kiwi.xml_state.description_type.contact", false]], "container_file (kiwi.xml_state.containert attribute)": [[1, "kiwi.xml_state.ContainerT.container_file", false]], "container_matches_host_architecture() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.container_matches_host_architecture", false]], "container_name (kiwi.container.oci.ociconfig attribute)": [[10, "kiwi.container.oci.OciConfig.container_name", false]], "container_tag (kiwi.container.oci.ociconfig attribute)": [[10, "kiwi.container.oci.OciConfig.container_tag", false]], "containerbuilder (class in kiwi.builder.container)": [[9, "kiwi.builder.container.ContainerBuilder", false]], "containerimage (class in kiwi.container)": [[10, "kiwi.container.ContainerImage", false]], "containerimageoci (class in kiwi.container.oci)": [[10, "kiwi.container.oci.ContainerImageOCI", false]], "containers_matches_host_architecture() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.containers_matches_host_architecture", false]], "containersetup (class in kiwi.container.setup)": [[11, "kiwi.container.setup.ContainerSetup", false]], "containersetupbase (class in kiwi.container.setup.base)": [[11, "kiwi.container.setup.base.ContainerSetupBase", false]], "containersetupdocker (class in kiwi.container.setup.docker)": [[11, "kiwi.container.setup.docker.ContainerSetupDocker", false]], "containert (class in kiwi.xml_state)": [[1, "kiwi.xml_state.ContainerT", false]], "copy_bootdelete_packages() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.copy_bootdelete_packages", false]], "copy_bootincluded_archives() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.copy_bootincluded_archives", false]], "copy_bootincluded_packages() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.copy_bootincluded_packages", false]], "copy_bootloader_section() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.copy_bootloader_section", false]], "copy_build_type_attributes() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.copy_build_type_attributes", false]], "copy_displayname() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.copy_displayname", false]], "copy_drivers_sections() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.copy_drivers_sections", false]], "copy_kernel() (kiwi.system.kernel.kernel method)": [[23, "kiwi.system.kernel.Kernel.copy_kernel", false]], "copy_machine_section() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.copy_machine_section", false]], "copy_name() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.copy_name", false]], "copy_oemconfig_section() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.copy_oemconfig_section", false]], "copy_preferences_subsections() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.copy_preferences_subsections", false]], "copy_repository_sections() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.copy_repository_sections", false]], "copy_strip_sections() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.copy_strip_sections", false]], "copy_systemdisk_section() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.copy_systemdisk_section", false]], "copy_xen_hypervisor() (kiwi.system.kernel.kernel method)": [[23, "kiwi.system.kernel.Kernel.copy_xen_hypervisor", false]], "create() (kiwi.archive.cpio.archivecpio method)": [[2, "kiwi.archive.cpio.ArchiveCpio.create", false]], "create() (kiwi.archive.tar.archivetar method)": [[2, "kiwi.archive.tar.ArchiveTar.create", false]], "create() (kiwi.builder.archive.archivebuilder method)": [[9, "kiwi.builder.archive.ArchiveBuilder.create", false]], "create() (kiwi.builder.container.containerbuilder method)": [[9, "kiwi.builder.container.ContainerBuilder.create", false]], "create() (kiwi.builder.disk.diskbuilder method)": [[9, "kiwi.builder.disk.DiskBuilder.create", false]], "create() (kiwi.builder.filesystem.filesystembuilder method)": [[9, "kiwi.builder.filesystem.FileSystemBuilder.create", false]], "create() (kiwi.builder.kis.kisbuilder method)": [[9, "kiwi.builder.kis.KisBuilder.create", false]], "create() (kiwi.builder.live.liveimagebuilder method)": [[9, "kiwi.builder.live.LiveImageBuilder.create", false]], "create() (kiwi.container.oci.containerimageoci method)": [[10, "kiwi.container.oci.ContainerImageOCI.create", false]], "create() (kiwi.partitioner.base.partitionerbase method)": [[15, "kiwi.partitioner.base.PartitionerBase.create", false]], "create() (kiwi.partitioner.dasd.partitionerdasd method)": [[15, "kiwi.partitioner.dasd.PartitionerDasd.create", false]], "create() (kiwi.partitioner.gpt.partitionergpt method)": [[15, "kiwi.partitioner.gpt.PartitionerGpt.create", false]], "create() (kiwi.partitioner.msdos.partitionermsdos method)": [[15, "kiwi.partitioner.msdos.PartitionerMsDos.create", false]], "create() (kiwi.path.path static method)": [[1, "kiwi.path.Path.create", false]], "create() (kiwi.storage.loop_device.loopdevice method)": [[20, "kiwi.storage.loop_device.LoopDevice.create", false]], "create() (kiwi.system.profile.profile method)": [[23, "kiwi.system.profile.Profile.create", false]], "create() (kiwi.system.root_init.rootinit method)": [[23, "kiwi.system.root_init.RootInit.create", false]], "create_boot_loader_config() (in module kiwi.bootloader.config)": [[6, "kiwi.bootloader.config.create_boot_loader_config", false]], "create_boot_partition() (kiwi.storage.disk.disk method)": [[20, "kiwi.storage.disk.Disk.create_boot_partition", false]], "create_box_img() (kiwi.storage.subformat.vagrant_base.diskformatvagrantbase method)": [[21, "kiwi.storage.subformat.vagrant_base.DiskFormatVagrantBase.create_box_img", false]], "create_box_img() (kiwi.storage.subformat.vagrant_libvirt.diskformatvagrantlibvirt method)": [[21, "kiwi.storage.subformat.vagrant_libvirt.DiskFormatVagrantLibVirt.create_box_img", false]], "create_box_img() (kiwi.storage.subformat.vagrant_virtualbox.diskformatvagrantvirtualbox method)": [[21, "kiwi.storage.subformat.vagrant_virtualbox.DiskFormatVagrantVirtualBox.create_box_img", false]], "create_crypto_luks() (kiwi.storage.luks_device.luksdevice method)": [[20, "kiwi.storage.luks_device.LuksDevice.create_crypto_luks", false]], "create_crypttab() (kiwi.storage.luks_device.luksdevice method)": [[20, "kiwi.storage.luks_device.LuksDevice.create_crypttab", false]], "create_custom_partitions() (kiwi.storage.disk.disk method)": [[20, "kiwi.storage.disk.Disk.create_custom_partitions", false]], "create_degraded_raid() (kiwi.storage.raid_device.raiddevice method)": [[20, "kiwi.storage.raid_device.RaidDevice.create_degraded_raid", false]], "create_disk() (kiwi.builder.disk.diskbuilder method)": [[9, "kiwi.builder.disk.DiskBuilder.create_disk", false]], "create_disk_format() (kiwi.builder.disk.diskbuilder method)": [[9, "kiwi.builder.disk.DiskBuilder.create_disk_format", false]], "create_efi_csm_partition() (kiwi.storage.disk.disk method)": [[20, "kiwi.storage.disk.Disk.create_efi_csm_partition", false]], "create_efi_partition() (kiwi.storage.disk.disk method)": [[20, "kiwi.storage.disk.Disk.create_efi_partition", false]], "create_efi_path() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.create_efi_path", false]], "create_fstab() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.create_fstab", false]], "create_gnu_gzip_compressed() (kiwi.archive.tar.archivetar method)": [[2, "kiwi.archive.tar.ArchiveTar.create_gnu_gzip_compressed", false]], "create_hybrid_mbr() (kiwi.storage.disk.disk method)": [[20, "kiwi.storage.disk.Disk.create_hybrid_mbr", false]], "create_image_format() (kiwi.storage.subformat.base.diskformatbase method)": [[21, "kiwi.storage.subformat.base.DiskFormatBase.create_image_format", false]], "create_image_format() (kiwi.storage.subformat.gce.diskformatgce method)": [[21, "kiwi.storage.subformat.gce.DiskFormatGce.create_image_format", false]], "create_image_format() (kiwi.storage.subformat.ova.diskformatova method)": [[21, "kiwi.storage.subformat.ova.DiskFormatOva.create_image_format", false]], "create_image_format() (kiwi.storage.subformat.qcow2.diskformatqcow2 method)": [[21, "kiwi.storage.subformat.qcow2.DiskFormatQcow2.create_image_format", false]], "create_image_format() (kiwi.storage.subformat.vagrant_base.diskformatvagrantbase method)": [[21, "kiwi.storage.subformat.vagrant_base.DiskFormatVagrantBase.create_image_format", false]], "create_image_format() (kiwi.storage.subformat.vdi.diskformatvdi method)": [[21, "kiwi.storage.subformat.vdi.DiskFormatVdi.create_image_format", false]], "create_image_format() (kiwi.storage.subformat.vhd.diskformatvhd method)": [[21, "kiwi.storage.subformat.vhd.DiskFormatVhd.create_image_format", false]], "create_image_format() (kiwi.storage.subformat.vhdfixed.diskformatvhdfixed method)": [[21, "kiwi.storage.subformat.vhdfixed.DiskFormatVhdFixed.create_image_format", false]], "create_image_format() (kiwi.storage.subformat.vhdx.diskformatvhdx method)": [[21, "kiwi.storage.subformat.vhdx.DiskFormatVhdx.create_image_format", false]], "create_image_format() (kiwi.storage.subformat.vmdk.diskformatvmdk method)": [[21, "kiwi.storage.subformat.vmdk.DiskFormatVmdk.create_image_format", false]], "create_init_link_from_linuxrc() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.create_init_link_from_linuxrc", false]], "create_initrd() (kiwi.boot.image.base.bootimagebase method)": [[4, "kiwi.boot.image.base.BootImageBase.create_initrd", false]], "create_initrd() (kiwi.boot.image.builtin_kiwi.bootimagekiwi method)": [[4, "kiwi.boot.image.builtin_kiwi.BootImageKiwi.create_initrd", false]], "create_initrd() (kiwi.boot.image.dracut.bootimagedracut method)": [[4, "kiwi.boot.image.dracut.BootImageDracut.create_initrd", false]], "create_install_iso() (kiwi.builder.install.installimagebuilder method)": [[9, "kiwi.builder.install.InstallImageBuilder.create_install_iso", false]], "create_install_media() (kiwi.builder.disk.diskbuilder method)": [[9, "kiwi.builder.disk.DiskBuilder.create_install_media", false]], "create_install_pxe_archive() (kiwi.builder.install.installimagebuilder method)": [[9, "kiwi.builder.install.InstallImageBuilder.create_install_pxe_archive", false]], "create_iso() (kiwi.iso_tools.base.isotoolsbase method)": [[13, "kiwi.iso_tools.base.IsoToolsBase.create_iso", false]], "create_iso() (kiwi.iso_tools.xorriso.isotoolsxorriso method)": [[13, "kiwi.iso_tools.xorriso.IsoToolsXorrIso.create_iso", false]], "create_loader_image() (kiwi.bootloader.config.systemd_boot.bootloadersystemdboot method)": [[6, "kiwi.bootloader.config.systemd_boot.BootLoaderSystemdBoot.create_loader_image", false]], "create_loader_image() (kiwi.bootloader.config.zipl.bootloaderzipl method)": [[6, "kiwi.bootloader.config.zipl.BootLoaderZipl.create_loader_image", false]], "create_match_method() (kiwi.command_process.commandprocess method)": [[1, "kiwi.command_process.CommandProcess.create_match_method", false]], "create_mbr() (kiwi.storage.disk.disk method)": [[20, "kiwi.storage.disk.Disk.create_mbr", false]], "create_on_device() (kiwi.filesystem.base.filesystembase method)": [[12, "kiwi.filesystem.base.FileSystemBase.create_on_device", false]], "create_on_device() (kiwi.filesystem.btrfs.filesystembtrfs method)": [[12, "kiwi.filesystem.btrfs.FileSystemBtrfs.create_on_device", false]], "create_on_device() (kiwi.filesystem.ext2.filesystemext2 method)": [[12, "kiwi.filesystem.ext2.FileSystemExt2.create_on_device", false]], "create_on_device() (kiwi.filesystem.ext3.filesystemext3 method)": [[12, "kiwi.filesystem.ext3.FileSystemExt3.create_on_device", false]], "create_on_device() (kiwi.filesystem.ext4.filesystemext4 method)": [[12, "kiwi.filesystem.ext4.FileSystemExt4.create_on_device", false]], "create_on_device() (kiwi.filesystem.fat16.filesystemfat16 method)": [[12, "kiwi.filesystem.fat16.FileSystemFat16.create_on_device", false]], "create_on_device() (kiwi.filesystem.fat32.filesystemfat32 method)": [[12, "kiwi.filesystem.fat32.FileSystemFat32.create_on_device", false]], "create_on_device() (kiwi.filesystem.xfs.filesystemxfs method)": [[12, "kiwi.filesystem.xfs.FileSystemXfs.create_on_device", false]], "create_on_file() (kiwi.filesystem.base.filesystembase method)": [[12, "kiwi.filesystem.base.FileSystemBase.create_on_file", false]], "create_on_file() (kiwi.filesystem.isofs.filesystemisofs method)": [[12, "kiwi.filesystem.isofs.FileSystemIsoFs.create_on_file", false]], "create_on_file() (kiwi.filesystem.squashfs.filesystemsquashfs method)": [[12, "kiwi.filesystem.squashfs.FileSystemSquashFs.create_on_file", false]], "create_prep_partition() (kiwi.storage.disk.disk method)": [[20, "kiwi.storage.disk.Disk.create_prep_partition", false]], "create_raid_config() (kiwi.storage.raid_device.raiddevice method)": [[20, "kiwi.storage.raid_device.RaidDevice.create_raid_config", false]], "create_random_keyfile() (kiwi.storage.luks_device.luksdevice static method)": [[20, "kiwi.storage.luks_device.LuksDevice.create_random_keyfile", false]], "create_recovery_archive() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.create_recovery_archive", false]], "create_repository_solvable() (kiwi.solver.repository.base.solverrepositorybase method)": [[19, "kiwi.solver.repository.base.SolverRepositoryBase.create_repository_solvable", false]], "create_root_lvm_partition() (kiwi.storage.disk.disk method)": [[20, "kiwi.storage.disk.Disk.create_root_lvm_partition", false]], "create_root_partition() (kiwi.storage.disk.disk method)": [[20, "kiwi.storage.disk.Disk.create_root_partition", false]], "create_root_raid_partition() (kiwi.storage.disk.disk method)": [[20, "kiwi.storage.disk.Disk.create_root_raid_partition", false]], "create_root_readonly_partition() (kiwi.storage.disk.disk method)": [[20, "kiwi.storage.disk.Disk.create_root_readonly_partition", false]], "create_spare_partition() (kiwi.storage.disk.disk method)": [[20, "kiwi.storage.disk.Disk.create_spare_partition", false]], "create_swap_partition() (kiwi.storage.disk.disk method)": [[20, "kiwi.storage.disk.Disk.create_swap_partition", false]], "create_verification_metadata() (kiwi.filesystem.base.filesystembase method)": [[12, "kiwi.filesystem.base.FileSystemBase.create_verification_metadata", false]], "create_verification_metadata() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.create_verification_metadata", false]], "create_verity_layer() (kiwi.filesystem.base.filesystembase method)": [[12, "kiwi.filesystem.base.FileSystemBase.create_verity_layer", false]], "create_verity_layer() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.create_verity_layer", false]], "create_volume_paths_in_root_dir() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.create_volume_paths_in_root_dir", false]], "create_volumes() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.create_volumes", false]], "create_volumes() (kiwi.volume_manager.btrfs.volumemanagerbtrfs method)": [[26, "kiwi.volume_manager.btrfs.VolumeManagerBtrfs.create_volumes", false]], "create_volumes() (kiwi.volume_manager.lvm.volumemanagerlvm method)": [[26, "kiwi.volume_manager.lvm.VolumeManagerLVM.create_volumes", false]], "create_xz_compressed() (kiwi.archive.tar.archivetar method)": [[2, "kiwi.archive.tar.ArchiveTar.create_xz_compressed", false]], "credentials_file_name() (kiwi.system.uri.uri method)": [[23, "kiwi.system.uri.Uri.credentials_file_name", false]], "custom_args (kiwi.volume_manager.base.volumemanagerbase attribute)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.custom_args", false]], "custom_filesystem_args (kiwi.volume_manager.base.volumemanagerbase attribute)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.custom_filesystem_args", false]], "customize() (kiwi.system.size.systemsize method)": [[23, "kiwi.system.size.SystemSize.customize", false]], "database_consistent() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.database_consistent", false]], "datasync (class in kiwi.utils.sync)": [[25, "kiwi.utils.sync.DataSync", false]], "deactivate_bootloader_setup() (kiwi.container.setup.base.containersetupbase method)": [[11, "kiwi.container.setup.base.ContainerSetupBase.deactivate_bootloader_setup", false]], "deactivate_root_filesystem_check() (kiwi.container.setup.base.containersetupbase method)": [[11, "kiwi.container.setup.base.ContainerSetupBase.deactivate_root_filesystem_check", false]], "deactivate_systemd_service() (kiwi.container.setup.base.containersetupbase method)": [[11, "kiwi.container.setup.base.ContainerSetupBase.deactivate_systemd_service", false]], "debugfilter (class in kiwi.logger_filter)": [[1, "kiwi.logger_filter.DebugFilter", false]], "defaults (class in kiwi.defaults)": [[1, "kiwi.defaults.Defaults", false]], "delete() (kiwi.system.profile.profile method)": [[23, "kiwi.system.profile.Profile.delete", false]], "delete() (kiwi.system.root_init.rootinit method)": [[23, "kiwi.system.root_init.RootInit.delete", false]], "delete_all_repos() (kiwi.repository.base.repositorybase method)": [[16, "kiwi.repository.base.RepositoryBase.delete_all_repos", false]], "delete_all_repos() (kiwi.repository.dnf4.repositorydnf4 method)": [[16, "kiwi.repository.dnf4.RepositoryDnf4.delete_all_repos", false]], "delete_all_repos() (kiwi.repository.zypper.repositoryzypper method)": [[16, "kiwi.repository.zypper.RepositoryZypper.delete_all_repos", false]], "delete_packages() (kiwi.system.prepare.systemprepare method)": [[23, "kiwi.system.prepare.SystemPrepare.delete_packages", false]], "delete_repo() (kiwi.repository.base.repositorybase method)": [[16, "kiwi.repository.base.RepositoryBase.delete_repo", false]], "delete_repo() (kiwi.repository.dnf4.repositorydnf4 method)": [[16, "kiwi.repository.dnf4.RepositoryDnf4.delete_repo", false]], "delete_repo() (kiwi.repository.zypper.repositoryzypper method)": [[16, "kiwi.repository.zypper.RepositoryZypper.delete_repo", false]], "delete_repo_cache() (kiwi.repository.base.repositorybase method)": [[16, "kiwi.repository.base.RepositoryBase.delete_repo_cache", false]], "delete_repo_cache() (kiwi.repository.dnf4.repositorydnf4 method)": [[16, "kiwi.repository.dnf4.RepositoryDnf4.delete_repo_cache", false]], "delete_repo_cache() (kiwi.repository.zypper.repositoryzypper method)": [[16, "kiwi.repository.zypper.RepositoryZypper.delete_repo_cache", false]], "delete_repository_sections() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.delete_repository_sections", false]], "delete_repository_sections_used_for_build() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.delete_repository_sections_used_for_build", false]], "description_type (class in kiwi.xml_state)": [[1, "kiwi.xml_state.description_type", false]], "device (kiwi.volume_manager.base.volumemanagerbase attribute)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.device", false]], "device_map (kiwi.volume_manager.base.volumemanagerbase attribute)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.device_map", false]], "device_provider_root (kiwi.volume_manager.base.volumemanagerbase attribute)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.device_provider_root", false]], "deviceprovider (class in kiwi.storage.device_provider)": [[20, "kiwi.storage.device_provider.DeviceProvider", false]], "disk (class in kiwi.storage.disk)": [[20, "kiwi.storage.disk.Disk", false]], "diskbuilder (class in kiwi.builder.disk)": [[9, "kiwi.builder.disk.DiskBuilder", false]], "diskformat (class in kiwi.storage.subformat)": [[21, "kiwi.storage.subformat.DiskFormat", false]], "diskformatbase (class in kiwi.storage.subformat.base)": [[21, "kiwi.storage.subformat.base.DiskFormatBase", false]], "diskformatgce (class in kiwi.storage.subformat.gce)": [[21, "kiwi.storage.subformat.gce.DiskFormatGce", false]], "diskformatova (class in kiwi.storage.subformat.ova)": [[21, "kiwi.storage.subformat.ova.DiskFormatOva", false]], "diskformatqcow2 (class in kiwi.storage.subformat.qcow2)": [[21, "kiwi.storage.subformat.qcow2.DiskFormatQcow2", false]], "diskformatvagrantbase (class in kiwi.storage.subformat.vagrant_base)": [[21, "kiwi.storage.subformat.vagrant_base.DiskFormatVagrantBase", false]], "diskformatvagrantlibvirt (class in kiwi.storage.subformat.vagrant_libvirt)": [[21, "kiwi.storage.subformat.vagrant_libvirt.DiskFormatVagrantLibVirt", false]], "diskformatvagrantvirtualbox (class in kiwi.storage.subformat.vagrant_virtualbox)": [[21, "kiwi.storage.subformat.vagrant_virtualbox.DiskFormatVagrantVirtualBox", false]], "diskformatvdi (class in kiwi.storage.subformat.vdi)": [[21, "kiwi.storage.subformat.vdi.DiskFormatVdi", false]], "diskformatvhd (class in kiwi.storage.subformat.vhd)": [[21, "kiwi.storage.subformat.vhd.DiskFormatVhd", false]], "diskformatvhdfixed (class in kiwi.storage.subformat.vhdfixed)": [[21, "kiwi.storage.subformat.vhdfixed.DiskFormatVhdFixed", false]], "diskformatvhdx (class in kiwi.storage.subformat.vhdx)": [[21, "kiwi.storage.subformat.vhdx.DiskFormatVhdx", false]], "diskformatvmdk (class in kiwi.storage.subformat.vmdk)": [[21, "kiwi.storage.subformat.vmdk.DiskFormatVmdk", false]], "disksetup (class in kiwi.storage.setup)": [[20, "kiwi.storage.setup.DiskSetup", false]], "download_from_repository() (kiwi.solver.repository.base.solverrepositorybase method)": [[19, "kiwi.solver.repository.base.SolverRepositoryBase.download_from_repository", false]], "dracut_module_type (class in kiwi.runtime_checker)": [[1, "kiwi.runtime_checker.dracut_module_type", false]], "dump() (kiwi.system.result.result method)": [[23, "kiwi.system.result.Result.dump", false]], "dump_reload_package_database() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.dump_reload_package_database", false]], "ec2_mode() (kiwi.firmware.firmware method)": [[1, "kiwi.firmware.FirmWare.ec2_mode", false]], "efi_mode() (kiwi.firmware.firmware method)": [[1, "kiwi.firmware.FirmWare.efi_mode", false]], "entry_command (kiwi.container.oci.ociconfig attribute)": [[10, "kiwi.container.oci.OciConfig.entry_command", false]], "entry_subcommand (kiwi.container.oci.ociconfig attribute)": [[10, "kiwi.container.oci.OciConfig.entry_subcommand", false]], "environment (kiwi.container.oci.ociconfig attribute)": [[10, "kiwi.container.oci.OciConfig.environment", false]], "error (kiwi.command.commandcallt attribute)": [[1, "kiwi.command.CommandCallT.error", false]], "error (kiwi.command.commandt attribute)": [[1, "kiwi.command.CommandT.error", false]], "error_available (kiwi.command.commandcallt attribute)": [[1, "kiwi.command.CommandCallT.error_available", false]], "errorfilter (class in kiwi.logger_filter)": [[1, "kiwi.logger_filter.ErrorFilter", false]], "export_modprobe_setup() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.export_modprobe_setup", false]], "export_package_changes() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.export_package_changes", false]], "export_package_list() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.export_package_list", false]], "export_package_verification() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.export_package_verification", false]], "expose_ports (kiwi.container.oci.ociconfig attribute)": [[10, "kiwi.container.oci.OciConfig.expose_ports", false]], "extract() (kiwi.archive.cpio.archivecpio method)": [[2, "kiwi.archive.cpio.ArchiveCpio.extract", false]], "extract() (kiwi.archive.tar.archivetar method)": [[2, "kiwi.archive.tar.ArchiveTar.extract", false]], "extras() (in module kiwi.kiwi)": [[1, "kiwi.kiwi.extras", false]], "failsafe_boot_entry_requested() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.failsafe_boot_entry_requested", false]], "fetch_command (kiwi.xml_state.containert attribute)": [[1, "kiwi.xml_state.ContainerT.fetch_command", false]], "fetch_only (kiwi.xml_state.containert attribute)": [[1, "kiwi.xml_state.ContainerT.fetch_only", false]], "filename (kiwi.defaults.grub_loader_type attribute)": [[1, "kiwi.defaults.grub_loader_type.filename", false]], "filename (kiwi.defaults.shim_loader_type attribute)": [[1, "kiwi.defaults.shim_loader_type.filename", false]], "filename (kiwi.system.kernel.kernel_type attribute)": [[23, "kiwi.system.kernel.kernel_type.filename", false]], "filename (kiwi.system.kernel.xen_hypervisor_type attribute)": [[23, "kiwi.system.kernel.xen_hypervisor_type.filename", false]], "filename (kiwi.system.result.result_file_type attribute)": [[23, "kiwi.system.result.result_file_type.filename", false]], "filesystem (class in kiwi.filesystem)": [[12, "kiwi.filesystem.FileSystem", false]], "filesystem (kiwi.storage.disk.ptable_entry_type attribute)": [[20, "kiwi.storage.disk.ptable_entry_type.filesystem", false]], "filesystembase (class in kiwi.filesystem.base)": [[12, "kiwi.filesystem.base.FileSystemBase", false]], "filesystembtrfs (class in kiwi.filesystem.btrfs)": [[12, "kiwi.filesystem.btrfs.FileSystemBtrfs", false]], "filesystembuilder (class in kiwi.builder.filesystem)": [[9, "kiwi.builder.filesystem.FileSystemBuilder", false]], "filesystemext2 (class in kiwi.filesystem.ext2)": [[12, "kiwi.filesystem.ext2.FileSystemExt2", false]], "filesystemext3 (class in kiwi.filesystem.ext3)": [[12, "kiwi.filesystem.ext3.FileSystemExt3", false]], "filesystemext4 (class in kiwi.filesystem.ext4)": [[12, "kiwi.filesystem.ext4.FileSystemExt4", false]], "filesystemfat16 (class in kiwi.filesystem.fat16)": [[12, "kiwi.filesystem.fat16.FileSystemFat16", false]], "filesystemfat32 (class in kiwi.filesystem.fat32)": [[12, "kiwi.filesystem.fat32.FileSystemFat32", false]], "filesystemisofs (class in kiwi.filesystem.isofs)": [[12, "kiwi.filesystem.isofs.FileSystemIsoFs", false]], "filesystemsetup (class in kiwi.filesystem.setup)": [[12, "kiwi.filesystem.setup.FileSystemSetup", false]], "filesystemsquashfs (class in kiwi.filesystem.squashfs)": [[12, "kiwi.filesystem.squashfs.FileSystemSquashFs", false]], "filesystemxfs (class in kiwi.filesystem.xfs)": [[12, "kiwi.filesystem.xfs.FileSystemXfs", false]], "filet (class in kiwi.xml_state)": [[1, "kiwi.xml_state.FileT", false]], "filter() (kiwi.logger_filter.debugfilter method)": [[1, "kiwi.logger_filter.DebugFilter.filter", false]], "filter() (kiwi.logger_filter.errorfilter method)": [[1, "kiwi.logger_filter.ErrorFilter.filter", false]], "filter() (kiwi.logger_filter.infofilter method)": [[1, "kiwi.logger_filter.InfoFilter.filter", false]], "filter() (kiwi.logger_filter.loggerschedulerfilter method)": [[1, "kiwi.logger_filter.LoggerSchedulerFilter.filter", false]], "filter() (kiwi.logger_filter.warningfilter method)": [[1, "kiwi.logger_filter.WarningFilter.filter", false]], "firmware (class in kiwi.firmware)": [[1, "kiwi.firmware.FirmWare", false]], "format() (kiwi.logger_color_formatter.colorformatter method)": [[1, "kiwi.logger_color_formatter.ColorFormatter.format", false]], "format_message() (kiwi.logger_color_formatter.colormessage method)": [[1, "kiwi.logger_color_formatter.ColorMessage.format_message", false]], "format_to_variable_value() (kiwi.system.shell.shell static method)": [[23, "kiwi.system.shell.Shell.format_to_variable_value", false]], "fullsize (kiwi.xml_state.volume_type attribute)": [[1, "kiwi.xml_state.volume_type.fullsize", false]], "gb (kiwi.defaults.unit_type attribute)": [[1, "kiwi.defaults.unit_type.gb", false]], "get() (kiwi.defaults.defaults method)": [[1, "kiwi.defaults.Defaults.get", false]], "get() (kiwi.utils.sysconfig.sysconfig method)": [[25, "kiwi.utils.sysconfig.SysConfig.get", false]], "get_additional_metadata() (kiwi.storage.subformat.vagrant_base.diskformatvagrantbase method)": [[21, "kiwi.storage.subformat.vagrant_base.DiskFormatVagrantBase.get_additional_metadata", false]], "get_additional_metadata() (kiwi.storage.subformat.vagrant_libvirt.diskformatvagrantlibvirt method)": [[21, "kiwi.storage.subformat.vagrant_libvirt.DiskFormatVagrantLibVirt.get_additional_metadata", false]], "get_additional_vagrant_config_settings() (kiwi.storage.subformat.vagrant_base.diskformatvagrantbase method)": [[21, "kiwi.storage.subformat.vagrant_base.DiskFormatVagrantBase.get_additional_vagrant_config_settings", false]], "get_additional_vagrant_config_settings() (kiwi.storage.subformat.vagrant_libvirt.diskformatvagrantlibvirt method)": [[21, "kiwi.storage.subformat.vagrant_libvirt.DiskFormatVagrantLibVirt.get_additional_vagrant_config_settings", false]], "get_additional_vagrant_config_settings() (kiwi.storage.subformat.vagrant_virtualbox.diskformatvagrantvirtualbox method)": [[21, "kiwi.storage.subformat.vagrant_virtualbox.DiskFormatVagrantVirtualBox.get_additional_vagrant_config_settings", false]], "get_archive_image_types() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_archive_image_types", false]], "get_archives_target_dirs() (kiwi.xml_state.xmlstate static method)": [[1, "kiwi.xml_state.XMLState.get_archives_target_dirs", false]], "get_attributes() (kiwi.mount_manager.mountmanager method)": [[1, "kiwi.mount_manager.MountManager.get_attributes", false]], "get_bios_image_name() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_bios_image_name", false]], "get_bios_module_directory_name() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_bios_module_directory_name", false]], "get_blkid() (kiwi.utils.block.blockid method)": [[25, "kiwi.utils.block.BlockID.get_blkid", false]], "get_bls_loader_entries_dir() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_bls_loader_entries_dir", false]], "get_boot_cmdline() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.get_boot_cmdline", false]], "get_boot_description_directory() (kiwi.boot.image.base.bootimagebase method)": [[4, "kiwi.boot.image.base.BootImageBase.get_boot_description_directory", false]], "get_boot_image_description_path() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_boot_image_description_path", false]], "get_boot_image_strip_file() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_boot_image_strip_file", false]], "get_boot_label() (kiwi.storage.setup.disksetup static method)": [[20, "kiwi.storage.setup.DiskSetup.get_boot_label", false]], "get_boot_names() (kiwi.boot.image.base.bootimagebase method)": [[4, "kiwi.boot.image.base.BootImageBase.get_boot_names", false]], "get_boot_path() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.get_boot_path", false]], "get_boot_theme() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.get_boot_theme", false]], "get_boot_timeout_seconds() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.get_boot_timeout_seconds", false]], "get_bootloader_config_options() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_bootloader_config_options", false]], "get_bootloader_install_options() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_bootloader_install_options", false]], "get_bootloader_options() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_bootloader_options", false]], "get_bootloader_shim_options() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_bootloader_shim_options", false]], "get_bootstrap_archives() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_bootstrap_archives", false]], "get_bootstrap_archives_target_dirs() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_bootstrap_archives_target_dirs", false]], "get_bootstrap_collection_type() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_bootstrap_collection_type", false]], "get_bootstrap_collections() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_bootstrap_collections", false]], "get_bootstrap_files() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_bootstrap_files", false]], "get_bootstrap_ignore_packages() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_bootstrap_ignore_packages", false]], "get_bootstrap_package_name() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_bootstrap_package_name", false]], "get_bootstrap_packages() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_bootstrap_packages", false]], "get_bootstrap_packages_sections() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_bootstrap_packages_sections", false]], "get_bootstrap_products() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_bootstrap_products", false]], "get_build_type_bootloader_bls() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_bootloader_bls", false]], "get_build_type_bootloader_console() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_bootloader_console", false]], "get_build_type_bootloader_name() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_bootloader_name", false]], "get_build_type_bootloader_section() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_bootloader_section", false]], "get_build_type_bootloader_securelinux_section() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_bootloader_securelinux_section", false]], "get_build_type_bootloader_serial_line_setup() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_bootloader_serial_line_setup", false]], "get_build_type_bootloader_settings_section() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_bootloader_settings_section", false]], "get_build_type_bootloader_targettype() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_bootloader_targettype", false]], "get_build_type_bootloader_timeout() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_bootloader_timeout", false]], "get_build_type_bootloader_timeout_style() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_bootloader_timeout_style", false]], "get_build_type_bootloader_use_disk_password() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_bootloader_use_disk_password", false]], "get_build_type_bundle_format() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_bundle_format", false]], "get_build_type_containerconfig_section() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_containerconfig_section", false]], "get_build_type_format_options() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_format_options", false]], "get_build_type_machine_section() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_machine_section", false]], "get_build_type_name() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_name", false]], "get_build_type_oemconfig_section() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_oemconfig_section", false]], "get_build_type_partitions_section() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_partitions_section", false]], "get_build_type_size() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_size", false]], "get_build_type_spare_part_fs_attributes() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_spare_part_fs_attributes", false]], "get_build_type_spare_part_size() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_spare_part_size", false]], "get_build_type_system_disk_section() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_system_disk_section", false]], "get_build_type_unpartitioned_bytes() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_unpartitioned_bytes", false]], "get_build_type_vagrant_config_section() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_vagrant_config_section", false]], "get_build_type_vmconfig_entries() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_vmconfig_entries", false]], "get_build_type_vmdisk_section() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_vmdisk_section", false]], "get_build_type_vmdvd_section() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_vmdvd_section", false]], "get_build_type_vmnic_entries() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_build_type_vmnic_entries", false]], "get_buildservice_env_name() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_buildservice_env_name", false]], "get_bundle_compression() (kiwi.runtime_config.runtimeconfig method)": [[1, "kiwi.runtime_config.RuntimeConfig.get_bundle_compression", false]], "get_byte_size() (kiwi.storage.device_provider.deviceprovider method)": [[20, "kiwi.storage.device_provider.DeviceProvider.get_byte_size", false]], "get_canonical_volume_list() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.get_canonical_volume_list", false]], "get_collection_modules() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_collection_modules", false]], "get_collection_type() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_collection_type", false]], "get_collections() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_collections", false]], "get_command() (kiwi.cli.cli method)": [[1, "kiwi.cli.Cli.get_command", false]], "get_command_args() (kiwi.cli.cli method)": [[1, "kiwi.cli.Cli.get_command_args", false]], "get_common_functions_file() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_common_functions_file", false]], "get_container_base_image_tag() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_container_base_image_tag", false]], "get_container_compression() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_container_compression", false]], "get_container_compression() (kiwi.runtime_config.runtimeconfig method)": [[1, "kiwi.runtime_config.RuntimeConfig.get_container_compression", false]], "get_container_config() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_container_config", false]], "get_container_image_types() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_container_image_types", false]], "get_container_name() (kiwi.container.setup.base.containersetupbase method)": [[11, "kiwi.container.setup.base.ContainerSetupBase.get_container_name", false]], "get_containers() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_containers", false]], "get_containers_sections() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_containers_sections", false]], "get_continue_on_timeout() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.get_continue_on_timeout", false]], "get_credentials_verification_metadata_signing_key_file() (kiwi.runtime_config.runtimeconfig method)": [[1, "kiwi.runtime_config.RuntimeConfig.get_credentials_verification_metadata_signing_key_file", false]], "get_custom_rpm_bootstrap_macro_name() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_custom_rpm_bootstrap_macro_name", false]], "get_custom_rpm_image_macro_name() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_custom_rpm_image_macro_name", false]], "get_custom_rpm_macros_path() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_custom_rpm_macros_path", false]], "get_default_boot_mbytes() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_default_boot_mbytes", false]], "get_default_boot_timeout_seconds() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_default_boot_timeout_seconds", false]], "get_default_bootloader() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_default_bootloader", false]], "get_default_container_created_by() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_default_container_created_by", false]], "get_default_container_name() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_default_container_name", false]], "get_default_container_subcommand() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_default_container_subcommand", false]], "get_default_container_tag() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_default_container_tag", false]], "get_default_disk_start_sector() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_default_disk_start_sector", false]], "get_default_efi_boot_mbytes() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_default_efi_boot_mbytes", false]], "get_default_efi_partition_table_type() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_default_efi_partition_table_type", false]], "get_default_firmware() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_default_firmware", false]], "get_default_inode_size() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_default_inode_size", false]], "get_default_legacy_bios_mbytes() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_default_legacy_bios_mbytes", false]], "get_default_live_iso_root_filesystem() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_default_live_iso_root_filesystem", false]], "get_default_live_iso_type() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_default_live_iso_type", false]], "get_default_package_manager() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_default_package_manager", false]], "get_default_packager_tool() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_default_packager_tool", false]], "get_default_prep_mbytes() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_default_prep_mbytes", false]], "get_default_uri_type() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_default_uri_type", false]], "get_default_video_mode() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_default_video_mode", false]], "get_default_volume_group_name() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_default_volume_group_name", false]], "get_derived_from_image_uri() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_derived_from_image_uri", false]], "get_description_section() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_description_section", false]], "get_device() (kiwi.storage.device_provider.deviceprovider method)": [[20, "kiwi.storage.device_provider.DeviceProvider.get_device", false]], "get_device() (kiwi.storage.disk.disk method)": [[20, "kiwi.storage.disk.Disk.get_device", false]], "get_device() (kiwi.storage.loop_device.loopdevice method)": [[20, "kiwi.storage.loop_device.LoopDevice.get_device", false]], "get_device() (kiwi.storage.luks_device.luksdevice method)": [[20, "kiwi.storage.luks_device.LuksDevice.get_device", false]], "get_device() (kiwi.storage.mapped_device.mappeddevice method)": [[20, "kiwi.storage.mapped_device.MappedDevice.get_device", false]], "get_device() (kiwi.storage.raid_device.raiddevice method)": [[20, "kiwi.storage.raid_device.RaidDevice.get_device", false]], "get_device() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.get_device", false]], "get_device() (kiwi.volume_manager.lvm.volumemanagerlvm method)": [[26, "kiwi.volume_manager.lvm.VolumeManagerLVM.get_device", false]], "get_disabled_runtime_checks() (kiwi.runtime_config.runtimeconfig method)": [[1, "kiwi.runtime_config.RuntimeConfig.get_disabled_runtime_checks", false]], "get_discoverable_partition_ids() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_discoverable_partition_ids", false]], "get_discoverable_partition_ids() (kiwi.storage.disk.disk method)": [[20, "kiwi.storage.disk.Disk.get_discoverable_partition_ids", false]], "get_disk_format_types() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_disk_format_types", false]], "get_disk_image_types() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_disk_image_types", false]], "get_disk_start_sector() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_disk_start_sector", false]], "get_disksize_mbytes() (kiwi.storage.setup.disksetup method)": [[20, "kiwi.storage.setup.DiskSetup.get_disksize_mbytes", false]], "get_distribution_name_from_boot_attribute() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_distribution_name_from_boot_attribute", false]], "get_dracut_conf_name() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_dracut_conf_name", false]], "get_drivers_list() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_drivers_list", false]], "get_ec2_capable_firmware_names() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_ec2_capable_firmware_names", false]], "get_efi_capable_firmware_names() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_efi_capable_firmware_names", false]], "get_efi_image_name() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_efi_image_name", false]], "get_efi_label() (kiwi.storage.setup.disksetup static method)": [[20, "kiwi.storage.setup.DiskSetup.get_efi_label", false]], "get_efi_module_directory_name() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_efi_module_directory_name", false]], "get_efi_partition_size() (kiwi.firmware.firmware method)": [[1, "kiwi.firmware.FirmWare.get_efi_partition_size", false]], "get_efi_vendor_directory() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_efi_vendor_directory", false]], "get_enclaves_image_types() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_enclaves_image_types", false]], "get_error_code() (kiwi.command_process.commanditerator method)": [[1, "kiwi.command_process.CommandIterator.get_error_code", false]], "get_error_details() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.get_error_details", false]], "get_error_output() (kiwi.command_process.commanditerator method)": [[1, "kiwi.command_process.CommandIterator.get_error_output", false]], "get_exclude_list_for_non_physical_devices() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_exclude_list_for_non_physical_devices", false]], "get_exclude_list_for_removed_files_detection() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_exclude_list_for_removed_files_detection", false]], "get_exclude_list_for_root_data_sync() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_exclude_list_for_root_data_sync", false]], "get_exclude_list_from_custom_exclude_files() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_exclude_list_from_custom_exclude_files", false]], "get_extension_xml_data() (kiwi.xml_description.xmldescription method)": [[1, "kiwi.xml_description.XMLDescription.get_extension_xml_data", false]], "get_failsafe_kernel_options() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_failsafe_kernel_options", false]], "get_filesystem() (kiwi.utils.block.blockid method)": [[25, "kiwi.utils.block.BlockID.get_filesystem", false]], "get_filesystem_image_types() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_filesystem_image_types", false]], "get_firmware_types() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_firmware_types", false]], "get_format() (kiwi.utils.compress.compress method)": [[25, "kiwi.utils.compress.Compress.get_format", false]], "get_fragment() (kiwi.system.uri.uri method)": [[23, "kiwi.system.uri.Uri.get_fragment", false]], "get_fs_create_option_list() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_fs_create_option_list", false]], "get_fs_mount_option_list() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_fs_mount_option_list", false]], "get_fstab() (kiwi.filesystem.base.filesystembase method)": [[12, "kiwi.filesystem.base.FileSystemBase.get_fstab", false]], "get_fstab() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.get_fstab", false]], "get_fstab() (kiwi.volume_manager.btrfs.volumemanagerbtrfs method)": [[26, "kiwi.volume_manager.btrfs.VolumeManagerBtrfs.get_fstab", false]], "get_fstab() (kiwi.volume_manager.lvm.volumemanagerlvm method)": [[26, "kiwi.volume_manager.lvm.VolumeManagerLVM.get_fstab", false]], "get_gfxmode() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.get_gfxmode", false]], "get_global_args() (kiwi.cli.cli method)": [[1, "kiwi.cli.Cli.get_global_args", false]], "get_grub_basic_modules() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_grub_basic_modules", false]], "get_grub_bios_core_loader() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_grub_bios_core_loader", false]], "get_grub_bios_modules() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_grub_bios_modules", false]], "get_grub_boot_directory_name() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_grub_boot_directory_name", false]], "get_grub_custom_arguments() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_grub_custom_arguments", false]], "get_grub_efi_font_directory() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_grub_efi_font_directory", false]], "get_grub_efi_modules() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_grub_efi_modules", false]], "get_grub_ofw_modules() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_grub_ofw_modules", false]], "get_grub_path() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_grub_path", false]], "get_grub_s390_modules() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_grub_s390_modules", false]], "get_host_key_certificates() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_host_key_certificates", false]], "get_host_template() (kiwi.repository.template.apt.packagemanagertemplateaptget method)": [[17, "kiwi.repository.template.apt.PackageManagerTemplateAptGet.get_host_template", false]], "get_id() (kiwi.partitioner.base.partitionerbase method)": [[15, "kiwi.partitioner.base.PartitionerBase.get_id", false]], "get_id() (kiwi.system.identifier.systemidentifier method)": [[23, "kiwi.system.identifier.SystemIdentifier.get_id", false]], "get_ignore_packages() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_ignore_packages", false]], "get_image_packages_sections() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_image_packages_sections", false]], "get_image_template() (kiwi.repository.template.apt.packagemanagertemplateaptget method)": [[17, "kiwi.repository.template.apt.PackageManagerTemplateAptGet.get_image_template", false]], "get_image_version() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_image_version", false]], "get_imported_root_image() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_imported_root_image", false]], "get_include_section_reference_file_names() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_include_section_reference_file_names", false]], "get_initrd_system() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_initrd_system", false]], "get_install_image_boot_default() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.get_install_image_boot_default", false]], "get_install_template() (kiwi.bootloader.template.grub2.bootloadertemplategrub2 method)": [[8, "kiwi.bootloader.template.grub2.BootLoaderTemplateGrub2.get_install_template", false]], "get_install_volume_id() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_install_volume_id", false]], "get_installmedia_initrd_modules() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_installmedia_initrd_modules", false]], "get_iso_boot_path() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_iso_boot_path", false]], "get_iso_grub_loader() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_iso_grub_loader", false]], "get_iso_grub_mbr() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_iso_grub_mbr", false]], "get_iso_media_tag_tool() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_iso_media_tag_tool", false]], "get_iso_media_tag_tool() (kiwi.runtime_config.runtimeconfig method)": [[1, "kiwi.runtime_config.RuntimeConfig.get_iso_media_tag_tool", false]], "get_iso_template() (kiwi.bootloader.template.grub2.bootloadertemplategrub2 method)": [[8, "kiwi.bootloader.template.grub2.BootLoaderTemplateGrub2.get_iso_template", false]], "get_iso_tool_category() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_iso_tool_category", false]], "get_iso_tool_category() (kiwi.runtime_config.runtimeconfig method)": [[1, "kiwi.runtime_config.RuntimeConfig.get_iso_tool_category", false]], "get_kernel() (kiwi.system.kernel.kernel method)": [[23, "kiwi.system.kernel.Kernel.get_kernel", false]], "get_kis_image_types() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_kis_image_types", false]], "get_label() (kiwi.utils.block.blockid method)": [[25, "kiwi.utils.block.BlockID.get_label", false]], "get_legacy_bios_partition_size() (kiwi.firmware.firmware method)": [[1, "kiwi.firmware.FirmWare.get_legacy_bios_partition_size", false]], "get_live_dracut_modules_from_flag() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_live_dracut_modules_from_flag", false]], "get_live_image_types() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_live_image_types", false]], "get_live_iso_persistent_boot_options() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_live_iso_persistent_boot_options", false]], "get_locale() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_locale", false]], "get_logfile() (kiwi.logger.logger method)": [[1, "kiwi.logger.Logger.get_logfile", false]], "get_luks_credentials() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_luks_credentials", false]], "get_luks_format_options() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_luks_format_options", false]], "get_luks_key_length() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_luks_key_length", false]], "get_lvm_overhead_mbytes() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_lvm_overhead_mbytes", false]], "get_mapper_tool() (kiwi.runtime_config.runtimeconfig method)": [[1, "kiwi.runtime_config.RuntimeConfig.get_mapper_tool", false]], "get_max_size_constraint() (kiwi.runtime_config.runtimeconfig method)": [[1, "kiwi.runtime_config.RuntimeConfig.get_max_size_constraint", false]], "get_menu_entry_install_title() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.get_menu_entry_install_title", false]], "get_menu_entry_title() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.get_menu_entry_title", false]], "get_min_partition_mbytes() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_min_partition_mbytes", false]], "get_min_volume_mbytes() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_min_volume_mbytes", false]], "get_mok_manager() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_mok_manager", false]], "get_mountpoint() (kiwi.filesystem.base.filesystembase method)": [[12, "kiwi.filesystem.base.FileSystemBase.get_mountpoint", false]], "get_mountpoint() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.get_mountpoint", false]], "get_mountpoint() (kiwi.volume_manager.btrfs.volumemanagerbtrfs method)": [[26, "kiwi.volume_manager.btrfs.VolumeManagerBtrfs.get_mountpoint", false]], "get_multiboot_install_template() (kiwi.bootloader.template.grub2.bootloadertemplategrub2 method)": [[8, "kiwi.bootloader.template.grub2.BootLoaderTemplateGrub2.get_multiboot_install_template", false]], "get_multiboot_iso_template() (kiwi.bootloader.template.grub2.bootloadertemplategrub2 method)": [[8, "kiwi.bootloader.template.grub2.BootLoaderTemplateGrub2.get_multiboot_iso_template", false]], "get_obs_api_credentials() (kiwi.runtime_config.runtimeconfig method)": [[1, "kiwi.runtime_config.RuntimeConfig.get_obs_api_credentials", false]], "get_obs_api_server_url() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_obs_api_server_url", false]], "get_obs_api_server_url() (kiwi.runtime_config.runtimeconfig method)": [[1, "kiwi.runtime_config.RuntimeConfig.get_obs_api_server_url", false]], "get_obs_download_server_url() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_obs_download_server_url", false]], "get_obs_download_server_url() (kiwi.runtime_config.runtimeconfig method)": [[1, "kiwi.runtime_config.RuntimeConfig.get_obs_download_server_url", false]], "get_oci_archive_tool() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_oci_archive_tool", false]], "get_oci_archive_tool() (kiwi.runtime_config.runtimeconfig method)": [[1, "kiwi.runtime_config.RuntimeConfig.get_oci_archive_tool", false]], "get_oemconfig_oem_multipath_scan() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_oemconfig_oem_multipath_scan", false]], "get_oemconfig_oem_resize() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_oemconfig_oem_resize", false]], "get_oemconfig_oem_systemsize() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_oemconfig_oem_systemsize", false]], "get_oemconfig_swap_mbytes() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_oemconfig_swap_mbytes", false]], "get_oemconfig_swap_name() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_oemconfig_swap_name", false]], "get_package_changes() (kiwi.runtime_config.runtimeconfig method)": [[1, "kiwi.runtime_config.RuntimeConfig.get_package_changes", false]], "get_package_manager() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_package_manager", false]], "get_package_sections() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_package_sections", false]], "get_packages_sections() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_packages_sections", false]], "get_part_mapper_tool() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_part_mapper_tool", false]], "get_partition_count() (kiwi.utils.block.blockid method)": [[25, "kiwi.utils.block.BlockID.get_partition_count", false]], "get_partition_table_type() (kiwi.firmware.firmware method)": [[1, "kiwi.firmware.FirmWare.get_partition_table_type", false]], "get_partitions() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_partitions", false]], "get_pid() (kiwi.command_process.commanditerator method)": [[1, "kiwi.command_process.CommandIterator.get_pid", false]], "get_platform_name() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_platform_name", false]], "get_preferences_sections() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_preferences_sections", false]], "get_prep_partition_size() (kiwi.firmware.firmware method)": [[1, "kiwi.firmware.FirmWare.get_prep_partition_size", false]], "get_preparer() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_preparer", false]], "get_products() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_products", false]], "get_profile_file() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_profile_file", false]], "get_public_partition_id_map() (kiwi.storage.disk.disk method)": [[20, "kiwi.storage.disk.Disk.get_public_partition_id_map", false]], "get_publisher() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_publisher", false]], "get_qemu_option_list() (kiwi.storage.subformat.base.diskformatbase static method)": [[21, "kiwi.storage.subformat.base.DiskFormatBase.get_qemu_option_list", false]], "get_recovery_spare_mbytes() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_recovery_spare_mbytes", false]], "get_release_version() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_release_version", false]], "get_removed_files_name() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_removed_files_name", false]], "get_repo_type() (kiwi.solver.repository.base.solverrepositorybase method)": [[19, "kiwi.solver.repository.base.SolverRepositoryBase.get_repo_type", false]], "get_repositories_signing_keys() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_repositories_signing_keys", false]], "get_repository_sections() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_repository_sections", false]], "get_repository_sections_used_for_build() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_repository_sections_used_for_build", false]], "get_repository_sections_used_in_image() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_repository_sections_used_in_image", false]], "get_results() (kiwi.system.result.result method)": [[23, "kiwi.system.result.Result.get_results", false]], "get_root_filesystem_uuid() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_root_filesystem_uuid", false]], "get_root_label() (kiwi.storage.setup.disksetup method)": [[20, "kiwi.storage.setup.DiskSetup.get_root_label", false]], "get_root_partition_uuid() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_root_partition_uuid", false]], "get_root_volume_name() (kiwi.filesystem.base.filesystembase method)": [[12, "kiwi.filesystem.base.FileSystemBase.get_root_volume_name", false]], "get_root_volume_name() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.get_root_volume_name", false]], "get_root_volume_name() (kiwi.volume_manager.btrfs.volumemanagerbtrfs method)": [[26, "kiwi.volume_manager.btrfs.VolumeManagerBtrfs.get_root_volume_name", false]], "get_rpm_check_signatures() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_rpm_check_signatures", false]], "get_rpm_excludedocs() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_rpm_excludedocs", false]], "get_rpm_locale() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_rpm_locale", false]], "get_rpm_locale_filtering() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_rpm_locale_filtering", false]], "get_runtime_checker_metadata() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_runtime_checker_metadata", false]], "get_schema_file() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_schema_file", false]], "get_schematron_module_name() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_schematron_module_name", false]], "get_servicename() (kiwi.cli.cli method)": [[1, "kiwi.cli.Cli.get_servicename", false]], "get_settings() (kiwi.system.profile.profile method)": [[23, "kiwi.system.profile.Profile.get_settings", false]], "get_shared_cache_location() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_shared_cache_location", false]], "get_shim_loader() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_shim_loader", false]], "get_shim_vendor_directory() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_shim_vendor_directory", false]], "get_signed_grub_loader() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_signed_grub_loader", false]], "get_size_mbytes() (kiwi.filesystem.setup.filesystemsetup method)": [[12, "kiwi.filesystem.setup.FileSystemSetup.get_size_mbytes", false]], "get_snapper_config_template_file() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_snapper_config_template_file", false]], "get_solvable_location() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_solvable_location", false]], "get_strip_files_to_delete() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_strip_files_to_delete", false]], "get_strip_libraries_to_keep() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_strip_libraries_to_keep", false]], "get_strip_list() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_strip_list", false]], "get_strip_tools_to_keep() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_strip_tools_to_keep", false]], "get_swapsize_mbytes() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_swapsize_mbytes", false]], "get_sync_options() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_sync_options", false]], "get_system_archives() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_system_archives", false]], "get_system_archives_target_dirs() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_system_archives_target_dirs", false]], "get_system_collection_type() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_system_collection_type", false]], "get_system_collections() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_system_collections", false]], "get_system_files() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_system_files", false]], "get_system_ignore_packages() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_system_ignore_packages", false]], "get_system_packages() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_system_packages", false]], "get_system_products() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_system_products", false]], "get_target_file_path_for_format() (kiwi.storage.subformat.base.diskformatbase method)": [[21, "kiwi.storage.subformat.base.DiskFormatBase.get_target_file_path_for_format", false]], "get_target_file_path_for_format() (kiwi.storage.subformat.gce.diskformatgce method)": [[21, "kiwi.storage.subformat.gce.DiskFormatGce.get_target_file_path_for_format", false]], "get_temp_location() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_temp_location", false]], "get_template() (kiwi.storage.subformat.template.vagrant_config.vagrantconfigtemplate method)": [[22, "kiwi.storage.subformat.template.vagrant_config.VagrantConfigTemplate.get_template", false]], "get_template() (kiwi.storage.subformat.template.virtualbox_ovf.virtualboxovftemplate method)": [[22, "kiwi.storage.subformat.template.virtualbox_ovf.VirtualboxOvfTemplate.get_template", false]], "get_template() (kiwi.storage.subformat.template.vmware_settings.vmwaresettingstemplate method)": [[22, "kiwi.storage.subformat.template.vmware_settings.VmwareSettingsTemplate.get_template", false]], "get_to_become_deleted_packages() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_to_become_deleted_packages", false]], "get_tool_name() (kiwi.iso_tools.base.isotoolsbase method)": [[13, "kiwi.iso_tools.base.IsoToolsBase.get_tool_name", false]], "get_tool_name() (kiwi.iso_tools.xorriso.isotoolsxorriso method)": [[13, "kiwi.iso_tools.xorriso.IsoToolsXorrIso.get_tool_name", false]], "get_unsigned_grub_loader() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_unsigned_grub_loader", false]], "get_user_groups() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_user_groups", false]], "get_users() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_users", false]], "get_users_sections() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_users_sections", false]], "get_uuid() (kiwi.storage.device_provider.deviceprovider method)": [[20, "kiwi.storage.device_provider.DeviceProvider.get_uuid", false]], "get_uuid() (kiwi.utils.block.blockid method)": [[25, "kiwi.utils.block.BlockID.get_uuid", false]], "get_vagrant_config_virtualbox_guest_additions() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_vagrant_config_virtualbox_guest_additions", false]], "get_vagrant_config_virtualbox_guest_additions() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_vagrant_config_virtualbox_guest_additions", false]], "get_vendor_grubenv() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_vendor_grubenv", false]], "get_video_mode_map() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_video_mode_map", false]], "get_volume_group_name() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_volume_group_name", false]], "get_volume_id() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_volume_id", false]], "get_volume_management() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_volume_management", false]], "get_volume_mbsize() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.get_volume_mbsize", false]], "get_volumes() (kiwi.filesystem.base.filesystembase method)": [[12, "kiwi.filesystem.base.FileSystemBase.get_volumes", false]], "get_volumes() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.get_volumes", false]], "get_volumes() (kiwi.volume_manager.btrfs.volumemanagerbtrfs method)": [[26, "kiwi.volume_manager.btrfs.VolumeManagerBtrfs.get_volumes", false]], "get_volumes() (kiwi.volume_manager.lvm.volumemanagerlvm method)": [[26, "kiwi.volume_manager.lvm.VolumeManagerLVM.get_volumes", false]], "get_volumes() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.get_volumes", false]], "get_xen_hypervisor() (kiwi.system.kernel.kernel method)": [[23, "kiwi.system.kernel.Kernel.get_xen_hypervisor", false]], "get_xsl_stylesheet_file() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_xsl_stylesheet_file", false]], "get_xz_compression_options() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.get_xz_compression_options", false]], "get_xz_options() (kiwi.runtime_config.runtimeconfig method)": [[1, "kiwi.runtime_config.RuntimeConfig.get_xz_options", false]], "getlogflags() (kiwi.logger.logger method)": [[1, "kiwi.logger.Logger.getLogFlags", false]], "getloglevel() (kiwi.logger.logger method)": [[1, "kiwi.logger.Logger.getLogLevel", false]], "group_add() (kiwi.system.users.users method)": [[23, "kiwi.system.users.Users.group_add", false]], "group_exists() (kiwi.system.users.users method)": [[23, "kiwi.system.users.Users.group_exists", false]], "grub_loader_type (class in kiwi.defaults)": [[1, "kiwi.defaults.grub_loader_type", false]], "guid (kiwi.storage.disk.disk attribute)": [[20, "kiwi.storage.disk.Disk.gUID", false]], "gzip() (kiwi.utils.compress.compress method)": [[25, "kiwi.utils.compress.Compress.gzip", false]], "has_failed() (kiwi.package_manager.base.packagemanagerbase static method)": [[14, "kiwi.package_manager.base.PackageManagerBase.has_failed", false]], "has_failed() (kiwi.package_manager.zypper.packagemanagerzypper static method)": [[14, "kiwi.package_manager.zypper.PackageManagerZypper.has_failed", false]], "has_initrd_support() (kiwi.boot.image.base.bootimagebase static method)": [[4, "kiwi.boot.image.base.BootImageBase.has_initrd_support", false]], "has_initrd_support() (kiwi.boot.image.builtin_kiwi.bootimagekiwi static method)": [[4, "kiwi.boot.image.builtin_kiwi.BootImageKiwi.has_initrd_support", false]], "has_initrd_support() (kiwi.boot.image.dracut.bootimagedracut static method)": [[4, "kiwi.boot.image.dracut.BootImageDracut.has_initrd_support", false]], "has_iso_hybrid_capability() (kiwi.iso_tools.base.isotoolsbase method)": [[13, "kiwi.iso_tools.base.IsoToolsBase.has_iso_hybrid_capability", false]], "has_iso_hybrid_capability() (kiwi.iso_tools.xorriso.isotoolsxorriso method)": [[13, "kiwi.iso_tools.xorriso.IsoToolsXorrIso.has_iso_hybrid_capability", false]], "has_raw_disk() (kiwi.storage.subformat.base.diskformatbase method)": [[21, "kiwi.storage.subformat.base.DiskFormatBase.has_raw_disk", false]], "help (class in kiwi.help)": [[1, "kiwi.help.Help", false]], "history (kiwi.container.oci.ociconfig attribute)": [[10, "kiwi.container.oci.OciConfig.history", false]], "i (kiwi.system.result.result_name_tags attribute)": [[23, "kiwi.system.result.result_name_tags.I", false]], "imagebuilder (class in kiwi.builder)": [[9, "kiwi.builder.ImageBuilder", false]], "import_cdroot_files() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.import_cdroot_files", false]], "import_description() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.import_description", false]], "import_files() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.import_files", false]], "import_image_identifier() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.import_image_identifier", false]], "import_overlay_files() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.import_overlay_files", false]], "import_repositories_marked_as_imageinclude() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.import_repositories_marked_as_imageinclude", false]], "import_system_description_elements() (kiwi.boot.image.base.bootimagebase method)": [[4, "kiwi.boot.image.base.BootImageBase.import_system_description_elements", false]], "import_trusted_keys() (kiwi.repository.base.repositorybase method)": [[16, "kiwi.repository.base.RepositoryBase.import_trusted_keys", false]], "import_trusted_keys() (kiwi.repository.dnf4.repositorydnf4 method)": [[16, "kiwi.repository.dnf4.RepositoryDnf4.import_trusted_keys", false]], "import_trusted_keys() (kiwi.repository.zypper.repositoryzypper method)": [[16, "kiwi.repository.zypper.RepositoryZypper.import_trusted_keys", false]], "include_file() (kiwi.boot.image.base.bootimagebase method)": [[4, "kiwi.boot.image.base.BootImageBase.include_file", false]], "include_file() (kiwi.boot.image.dracut.bootimagedracut method)": [[4, "kiwi.boot.image.dracut.BootImageDracut.include_file", false]], "include_module() (kiwi.boot.image.base.bootimagebase method)": [[4, "kiwi.boot.image.base.BootImageBase.include_module", false]], "include_module() (kiwi.boot.image.dracut.bootimagedracut method)": [[4, "kiwi.boot.image.dracut.BootImageDracut.include_module", false]], "infofilter (class in kiwi.logger_filter)": [[1, "kiwi.logger_filter.InfoFilter", false]], "init_iso_creation_parameters() (kiwi.iso_tools.base.isotoolsbase method)": [[13, "kiwi.iso_tools.base.IsoToolsBase.init_iso_creation_parameters", false]], "init_iso_creation_parameters() (kiwi.iso_tools.xorriso.isotoolsxorriso method)": [[13, "kiwi.iso_tools.xorriso.IsoToolsXorrIso.init_iso_creation_parameters", false]], "initrd_name (kiwi.boot.image.base.boot_names_type attribute)": [[4, "kiwi.boot.image.base.boot_names_type.initrd_name", false]], "install() (kiwi.bootloader.install.base.bootloaderinstallbase method)": [[7, "kiwi.bootloader.install.base.BootLoaderInstallBase.install", false]], "install() (kiwi.bootloader.install.grub2.bootloaderinstallgrub2 method)": [[7, "kiwi.bootloader.install.grub2.BootLoaderInstallGrub2.install", false]], "install_bootstrap() (kiwi.system.prepare.systemprepare method)": [[23, "kiwi.system.prepare.SystemPrepare.install_bootstrap", false]], "install_packages() (kiwi.system.prepare.systemprepare method)": [[23, "kiwi.system.prepare.SystemPrepare.install_packages", false]], "install_required() (kiwi.bootloader.install.base.bootloaderinstallbase method)": [[7, "kiwi.bootloader.install.base.BootLoaderInstallBase.install_required", false]], "install_required() (kiwi.bootloader.install.grub2.bootloaderinstallgrub2 method)": [[7, "kiwi.bootloader.install.grub2.BootLoaderInstallGrub2.install_required", false]], "install_required() (kiwi.bootloader.install.systemd_boot.bootloaderinstallsystemdboot method)": [[7, "kiwi.bootloader.install.systemd_boot.BootLoaderInstallSystemdBoot.install_required", false]], "install_required() (kiwi.bootloader.install.zipl.bootloaderinstallzipl method)": [[7, "kiwi.bootloader.install.zipl.BootLoaderInstallZipl.install_required", false]], "install_system() (kiwi.system.prepare.systemprepare method)": [[23, "kiwi.system.prepare.SystemPrepare.install_system", false]], "installimagebuilder (class in kiwi.builder.install)": [[9, "kiwi.builder.install.InstallImageBuilder", false]], "integrity_root (kiwi.builder.disk.storagemap attribute)": [[9, "kiwi.builder.disk.StorageMap.integrity_root", false]], "is_buildservice_worker() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.is_buildservice_worker", false]], "is_loop() (kiwi.storage.device_provider.deviceprovider method)": [[20, "kiwi.storage.device_provider.DeviceProvider.is_loop", false]], "is_loop() (kiwi.storage.disk.disk method)": [[20, "kiwi.storage.disk.Disk.is_loop", false]], "is_loop() (kiwi.storage.loop_device.loopdevice method)": [[20, "kiwi.storage.loop_device.LoopDevice.is_loop", false]], "is_loop() (kiwi.storage.luks_device.luksdevice method)": [[20, "kiwi.storage.luks_device.LuksDevice.is_loop", false]], "is_loop() (kiwi.storage.mapped_device.mappeddevice method)": [[20, "kiwi.storage.mapped_device.MappedDevice.is_loop", false]], "is_loop() (kiwi.storage.raid_device.raiddevice method)": [[20, "kiwi.storage.raid_device.RaidDevice.is_loop", false]], "is_loop() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.is_loop", false]], "is_mounted() (kiwi.mount_manager.mountmanager method)": [[1, "kiwi.mount_manager.MountManager.is_mounted", false]], "is_obs_public() (kiwi.runtime_config.runtimeconfig method)": [[1, "kiwi.runtime_config.RuntimeConfig.is_obs_public", false]], "is_ppc64_arch() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.is_ppc64_arch", false]], "is_prepared() (kiwi.boot.image.base.bootimagebase method)": [[4, "kiwi.boot.image.base.BootImageBase.is_prepared", false]], "is_public() (kiwi.system.uri.uri method)": [[23, "kiwi.system.uri.Uri.is_public", false]], "is_remote() (kiwi.system.uri.uri method)": [[23, "kiwi.system.uri.Uri.is_remote", false]], "is_root_volume (kiwi.xml_state.volume_type attribute)": [[1, "kiwi.xml_state.volume_type.is_root_volume", false]], "is_uptodate() (kiwi.solver.repository.base.solverrepositorybase method)": [[19, "kiwi.solver.repository.base.SolverRepositoryBase.is_uptodate", false]], "is_x86_arch() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.is_x86_arch", false]], "is_xen_guest() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.is_xen_guest", false]], "is_xen_server() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.is_xen_server", false]], "iso (class in kiwi.iso_tools.iso)": [[13, "kiwi.iso_tools.iso.Iso", false]], "isotools (class in kiwi.iso_tools)": [[13, "kiwi.iso_tools.IsoTools", false]], "isotoolsbase (class in kiwi.iso_tools.base)": [[13, "kiwi.iso_tools.base.IsoToolsBase", false]], "isotoolsxorriso (class in kiwi.iso_tools.xorriso)": [[13, "kiwi.iso_tools.xorriso.IsoToolsXorrIso", false]], "kb (kiwi.defaults.unit_type attribute)": [[1, "kiwi.defaults.unit_type.kb", false]], "kernel (class in kiwi.system.kernel)": [[23, "kiwi.system.kernel.Kernel", false]], "kernel_filename (kiwi.boot.image.base.boot_names_type attribute)": [[4, "kiwi.boot.image.base.boot_names_type.kernel_filename", false]], "kernel_name (kiwi.boot.image.base.boot_names_type attribute)": [[4, "kiwi.boot.image.base.boot_names_type.kernel_name", false]], "kernel_type (class in kiwi.system.kernel)": [[23, "kiwi.system.kernel.kernel_type", false]], "kernel_version (kiwi.boot.image.base.boot_names_type attribute)": [[4, "kiwi.boot.image.base.boot_names_type.kernel_version", false]], "kill() (kiwi.command_process.commanditerator method)": [[1, "kiwi.command_process.CommandIterator.kill", false]], "kisbuilder (class in kiwi.builder.kis)": [[9, "kiwi.builder.kis.KisBuilder", false]], "kiwi": [[1, "module-kiwi", false]], "kiwi.app": [[1, "module-kiwi.app", false]], "kiwi.archive": [[2, "module-kiwi.archive", false]], "kiwi.archive.cpio": [[2, "module-kiwi.archive.cpio", false]], "kiwi.archive.tar": [[2, "module-kiwi.archive.tar", false]], "kiwi.boot": [[3, "module-kiwi.boot", false]], "kiwi.boot.image": [[4, "module-kiwi.boot.image", false]], "kiwi.boot.image.base": [[4, "module-kiwi.boot.image.base", false]], "kiwi.boot.image.builtin_kiwi": [[4, "module-kiwi.boot.image.builtin_kiwi", false]], "kiwi.boot.image.dracut": [[4, "module-kiwi.boot.image.dracut", false]], "kiwi.bootloader": [[5, "module-kiwi.bootloader", false]], "kiwi.bootloader.config": [[6, "module-kiwi.bootloader.config", false]], "kiwi.bootloader.config.base": [[6, "module-kiwi.bootloader.config.base", false]], "kiwi.bootloader.config.grub2": [[6, "module-kiwi.bootloader.config.grub2", false]], "kiwi.bootloader.config.systemd_boot": [[6, "module-kiwi.bootloader.config.systemd_boot", false]], "kiwi.bootloader.config.zipl": [[6, "module-kiwi.bootloader.config.zipl", false]], "kiwi.bootloader.install": [[7, "module-kiwi.bootloader.install", false]], "kiwi.bootloader.install.base": [[7, "module-kiwi.bootloader.install.base", false]], "kiwi.bootloader.install.grub2": [[7, "module-kiwi.bootloader.install.grub2", false]], "kiwi.bootloader.install.systemd_boot": [[7, "module-kiwi.bootloader.install.systemd_boot", false]], "kiwi.bootloader.install.zipl": [[7, "module-kiwi.bootloader.install.zipl", false]], "kiwi.bootloader.template": [[8, "module-kiwi.bootloader.template", false]], "kiwi.bootloader.template.grub2": [[8, "module-kiwi.bootloader.template.grub2", false]], "kiwi.builder": [[9, "module-kiwi.builder", false]], "kiwi.builder.archive": [[9, "module-kiwi.builder.archive", false]], "kiwi.builder.container": [[9, "module-kiwi.builder.container", false]], "kiwi.builder.disk": [[9, "module-kiwi.builder.disk", false]], "kiwi.builder.filesystem": [[9, "module-kiwi.builder.filesystem", false]], "kiwi.builder.install": [[9, "module-kiwi.builder.install", false]], "kiwi.builder.kis": [[9, "module-kiwi.builder.kis", false]], "kiwi.builder.live": [[9, "module-kiwi.builder.live", false]], "kiwi.cli": [[1, "module-kiwi.cli", false]], "kiwi.command": [[1, "module-kiwi.command", false]], "kiwi.command_process": [[1, "module-kiwi.command_process", false]], "kiwi.container": [[10, "module-kiwi.container", false]], "kiwi.container.oci": [[10, "module-kiwi.container.oci", false]], "kiwi.container.setup": [[11, "module-kiwi.container.setup", false]], "kiwi.container.setup.base": [[11, "module-kiwi.container.setup.base", false]], "kiwi.container.setup.docker": [[11, "module-kiwi.container.setup.docker", false]], "kiwi.defaults": [[1, "module-kiwi.defaults", false]], "kiwi.exceptions": [[1, "module-kiwi.exceptions", false]], "kiwi.filesystem": [[12, "module-kiwi.filesystem", false]], "kiwi.filesystem.base": [[12, "module-kiwi.filesystem.base", false]], "kiwi.filesystem.btrfs": [[12, "module-kiwi.filesystem.btrfs", false]], "kiwi.filesystem.ext2": [[12, "module-kiwi.filesystem.ext2", false]], "kiwi.filesystem.ext3": [[12, "module-kiwi.filesystem.ext3", false]], "kiwi.filesystem.ext4": [[12, "module-kiwi.filesystem.ext4", false]], "kiwi.filesystem.fat16": [[12, "module-kiwi.filesystem.fat16", false]], "kiwi.filesystem.fat32": [[12, "module-kiwi.filesystem.fat32", false]], "kiwi.filesystem.isofs": [[12, "module-kiwi.filesystem.isofs", false]], "kiwi.filesystem.setup": [[12, "module-kiwi.filesystem.setup", false]], "kiwi.filesystem.squashfs": [[12, "module-kiwi.filesystem.squashfs", false]], "kiwi.filesystem.xfs": [[12, "module-kiwi.filesystem.xfs", false]], "kiwi.firmware": [[1, "module-kiwi.firmware", false]], "kiwi.help": [[1, "module-kiwi.help", false]], "kiwi.iso_tools": [[13, "module-kiwi.iso_tools", false]], "kiwi.iso_tools.base": [[13, "module-kiwi.iso_tools.base", false]], "kiwi.iso_tools.iso": [[13, "module-kiwi.iso_tools.iso", false]], "kiwi.iso_tools.xorriso": [[13, "module-kiwi.iso_tools.xorriso", false]], "kiwi.kiwi": [[1, "module-kiwi.kiwi", false]], "kiwi.logger": [[1, "module-kiwi.logger", false]], "kiwi.logger_color_formatter": [[1, "module-kiwi.logger_color_formatter", false]], "kiwi.logger_filter": [[1, "module-kiwi.logger_filter", false]], "kiwi.mount_manager": [[1, "module-kiwi.mount_manager", false]], "kiwi.package_manager": [[14, "module-kiwi.package_manager", false]], "kiwi.package_manager.base": [[14, "module-kiwi.package_manager.base", false]], "kiwi.package_manager.dnf4": [[14, "module-kiwi.package_manager.dnf4", false]], "kiwi.package_manager.zypper": [[14, "module-kiwi.package_manager.zypper", false]], "kiwi.partitioner": [[15, "module-kiwi.partitioner", false]], "kiwi.partitioner.base": [[15, "module-kiwi.partitioner.base", false]], "kiwi.partitioner.dasd": [[15, "module-kiwi.partitioner.dasd", false]], "kiwi.partitioner.gpt": [[15, "module-kiwi.partitioner.gpt", false]], "kiwi.partitioner.msdos": [[15, "module-kiwi.partitioner.msdos", false]], "kiwi.path": [[1, "module-kiwi.path", false]], "kiwi.privileges": [[1, "module-kiwi.privileges", false]], "kiwi.repository": [[16, "module-kiwi.repository", false]], "kiwi.repository.base": [[16, "module-kiwi.repository.base", false]], "kiwi.repository.dnf4": [[16, "module-kiwi.repository.dnf4", false]], "kiwi.repository.template": [[17, "module-kiwi.repository.template", false]], "kiwi.repository.template.apt": [[17, "module-kiwi.repository.template.apt", false]], "kiwi.repository.zypper": [[16, "module-kiwi.repository.zypper", false]], "kiwi.runtime_checker": [[1, "module-kiwi.runtime_checker", false]], "kiwi.runtime_config": [[1, "module-kiwi.runtime_config", false]], "kiwi.solver": [[18, "module-kiwi.solver", false]], "kiwi.solver.repository": [[19, "module-kiwi.solver.repository", false]], "kiwi.solver.repository.base": [[19, "module-kiwi.solver.repository.base", false]], "kiwi.solver.repository.rpm_dir": [[19, "module-kiwi.solver.repository.rpm_dir", false]], "kiwi.solver.repository.rpm_md": [[19, "module-kiwi.solver.repository.rpm_md", false]], "kiwi.solver.repository.suse": [[19, "module-kiwi.solver.repository.suse", false]], "kiwi.solver.sat": [[18, "module-kiwi.solver.sat", false]], "kiwi.storage": [[20, "module-kiwi.storage", false]], "kiwi.storage.clone_device": [[20, "module-kiwi.storage.clone_device", false]], "kiwi.storage.device_provider": [[20, "module-kiwi.storage.device_provider", false]], "kiwi.storage.disk": [[20, "module-kiwi.storage.disk", false]], "kiwi.storage.loop_device": [[20, "module-kiwi.storage.loop_device", false]], "kiwi.storage.luks_device": [[20, "module-kiwi.storage.luks_device", false]], "kiwi.storage.mapped_device": [[20, "module-kiwi.storage.mapped_device", false]], "kiwi.storage.raid_device": [[20, "module-kiwi.storage.raid_device", false]], "kiwi.storage.setup": [[20, "module-kiwi.storage.setup", false]], "kiwi.storage.subformat": [[21, "module-kiwi.storage.subformat", false]], "kiwi.storage.subformat.base": [[21, "module-kiwi.storage.subformat.base", false]], "kiwi.storage.subformat.gce": [[21, "module-kiwi.storage.subformat.gce", false]], "kiwi.storage.subformat.ova": [[21, "module-kiwi.storage.subformat.ova", false]], "kiwi.storage.subformat.qcow2": [[21, "module-kiwi.storage.subformat.qcow2", false]], "kiwi.storage.subformat.template": [[22, "module-kiwi.storage.subformat.template", false]], "kiwi.storage.subformat.template.vagrant_config": [[22, "module-kiwi.storage.subformat.template.vagrant_config", false]], "kiwi.storage.subformat.template.virtualbox_ovf": [[22, "module-kiwi.storage.subformat.template.virtualbox_ovf", false]], "kiwi.storage.subformat.template.vmware_settings": [[22, "module-kiwi.storage.subformat.template.vmware_settings", false]], "kiwi.storage.subformat.vagrant_base": [[21, "module-kiwi.storage.subformat.vagrant_base", false]], "kiwi.storage.subformat.vagrant_libvirt": [[21, "module-kiwi.storage.subformat.vagrant_libvirt", false]], "kiwi.storage.subformat.vagrant_virtualbox": [[21, "module-kiwi.storage.subformat.vagrant_virtualbox", false]], "kiwi.storage.subformat.vdi": [[21, "module-kiwi.storage.subformat.vdi", false]], "kiwi.storage.subformat.vhd": [[21, "module-kiwi.storage.subformat.vhd", false]], "kiwi.storage.subformat.vhdfixed": [[21, "module-kiwi.storage.subformat.vhdfixed", false]], "kiwi.storage.subformat.vhdx": [[21, "module-kiwi.storage.subformat.vhdx", false]], "kiwi.storage.subformat.vmdk": [[21, "module-kiwi.storage.subformat.vmdk", false]], "kiwi.system": [[23, "module-kiwi.system", false]], "kiwi.system.identifier": [[23, "module-kiwi.system.identifier", false]], "kiwi.system.kernel": [[23, "module-kiwi.system.kernel", false]], "kiwi.system.prepare": [[23, "module-kiwi.system.prepare", false]], "kiwi.system.profile": [[23, "module-kiwi.system.profile", false]], "kiwi.system.result": [[23, "module-kiwi.system.result", false]], "kiwi.system.root_bind": [[23, "module-kiwi.system.root_bind", false]], "kiwi.system.root_init": [[23, "module-kiwi.system.root_init", false]], "kiwi.system.setup": [[23, "module-kiwi.system.setup", false]], "kiwi.system.shell": [[23, "module-kiwi.system.shell", false]], "kiwi.system.size": [[23, "module-kiwi.system.size", false]], "kiwi.system.uri": [[23, "module-kiwi.system.uri", false]], "kiwi.system.users": [[23, "module-kiwi.system.users", false]], "kiwi.tasks": [[24, "module-kiwi.tasks", false]], "kiwi.tasks.base": [[24, "module-kiwi.tasks.base", false]], "kiwi.tasks.result_bundle": [[24, "module-kiwi.tasks.result_bundle", false]], "kiwi.tasks.result_list": [[24, "module-kiwi.tasks.result_list", false]], "kiwi.tasks.system_build": [[24, "module-kiwi.tasks.system_build", false]], "kiwi.tasks.system_create": [[24, "module-kiwi.tasks.system_create", false]], "kiwi.tasks.system_prepare": [[24, "module-kiwi.tasks.system_prepare", false]], "kiwi.tasks.system_update": [[24, "module-kiwi.tasks.system_update", false]], "kiwi.utils": [[25, "module-kiwi.utils", false]], "kiwi.utils.block": [[25, "module-kiwi.utils.block", false]], "kiwi.utils.checksum": [[25, "module-kiwi.utils.checksum", false]], "kiwi.utils.compress": [[25, "module-kiwi.utils.compress", false]], "kiwi.utils.sync": [[25, "module-kiwi.utils.sync", false]], "kiwi.utils.sysconfig": [[25, "module-kiwi.utils.sysconfig", false]], "kiwi.version": [[1, "module-kiwi.version", false]], "kiwi.volume_manager": [[26, "module-kiwi.volume_manager", false]], "kiwi.volume_manager.base": [[26, "module-kiwi.volume_manager.base", false]], "kiwi.volume_manager.btrfs": [[26, "module-kiwi.volume_manager.btrfs", false]], "kiwi.volume_manager.lvm": [[26, "module-kiwi.volume_manager.lvm", false]], "kiwi.xml_description": [[1, "module-kiwi.xml_description", false]], "kiwi.xml_state": [[1, "module-kiwi.xml_state", false]], "kiwianymarkuppluginerror": [[1, "kiwi.exceptions.KiwiAnyMarkupPluginError", false]], "kiwiarchivesetuperror": [[1, "kiwi.exceptions.KiwiArchiveSetupError", false]], "kiwiarchivetarerror": [[1, "kiwi.exceptions.KiwiArchiveTarError", false]], "kiwibootimagesetuperror": [[1, "kiwi.exceptions.KiwiBootImageSetupError", false]], "kiwibootloaderconfigsetuperror": [[1, "kiwi.exceptions.KiwiBootLoaderConfigSetupError", false]], "kiwibootloaderdiskpassworderror": [[1, "kiwi.exceptions.KiwiBootLoaderDiskPasswordError", false]], "kiwibootloadergrubdataerror": [[1, "kiwi.exceptions.KiwiBootLoaderGrubDataError", false]], "kiwibootloadergrubfonterror": [[1, "kiwi.exceptions.KiwiBootLoaderGrubFontError", false]], "kiwibootloadergrubinstallerror": [[1, "kiwi.exceptions.KiwiBootLoaderGrubInstallError", false]], "kiwibootloadergrubmoduleserror": [[1, "kiwi.exceptions.KiwiBootLoaderGrubModulesError", false]], "kiwibootloadergrubplatformerror": [[1, "kiwi.exceptions.KiwiBootLoaderGrubPlatformError", false]], "kiwibootloadergrubsecurebooterror": [[1, "kiwi.exceptions.KiwiBootLoaderGrubSecureBootError", false]], "kiwibootloaderinstallsetuperror": [[1, "kiwi.exceptions.KiwiBootLoaderInstallSetupError", false]], "kiwibootloadertargeterror": [[1, "kiwi.exceptions.KiwiBootLoaderTargetError", false]], "kiwibootloaderziplinstallerror": [[1, "kiwi.exceptions.KiwiBootLoaderZiplInstallError", false]], "kiwibootloaderziplplatformerror": [[1, "kiwi.exceptions.KiwiBootLoaderZiplPlatformError", false]], "kiwibootloaderziplsetuperror": [[1, "kiwi.exceptions.KiwiBootLoaderZiplSetupError", false]], "kiwibootstrapphasefailed": [[1, "kiwi.exceptions.KiwiBootStrapPhaseFailed", false]], "kiwibuildaherror": [[1, "kiwi.exceptions.KiwiBuildahError", false]], "kiwibundleerror": [[1, "kiwi.exceptions.KiwiBundleError", false]], "kiwicommandcapabilitieserror": [[1, "kiwi.exceptions.KiwiCommandCapabilitiesError", false]], "kiwicommanderror": [[1, "kiwi.exceptions.KiwiCommandError", false]], "kiwicommandnotfound": [[1, "kiwi.exceptions.KiwiCommandNotFound", false]], "kiwicommandnotloaded": [[1, "kiwi.exceptions.KiwiCommandNotLoaded", false]], "kiwicompressionformatunknown": [[1, "kiwi.exceptions.KiwiCompressionFormatUnknown", false]], "kiwiconfigfileformatnotsupported": [[1, "kiwi.exceptions.KiwiConfigFileFormatNotSupported", false]], "kiwiconfigfilenotfound": [[1, "kiwi.exceptions.KiwiConfigFileNotFound", false]], "kiwicontainerbuildererror": [[1, "kiwi.exceptions.KiwiContainerBuilderError", false]], "kiwicontainerimagesetuperror": [[1, "kiwi.exceptions.KiwiContainerImageSetupError", false]], "kiwicontainersetuperror": [[1, "kiwi.exceptions.KiwiContainerSetupError", false]], "kiwicredentialserror": [[1, "kiwi.exceptions.KiwiCredentialsError", false]], "kiwicustompartitionconflicterror": [[1, "kiwi.exceptions.KiwiCustomPartitionConflictError", false]], "kiwidatastructureerror": [[1, "kiwi.exceptions.KiwiDataStructureError", false]], "kiwidebianbootstraperror": [[1, "kiwi.exceptions.KiwiDebianBootstrapError", false]], "kiwidecodingerror": [[1, "kiwi.exceptions.KiwiDecodingError", false]], "kiwidescriptioninvalid": [[1, "kiwi.exceptions.KiwiDescriptionInvalid", false]], "kiwideviceprovidererror": [[1, "kiwi.exceptions.KiwiDeviceProviderError", false]], "kiwidiskbootimageerror": [[1, "kiwi.exceptions.KiwiDiskBootImageError", false]], "kiwidiskformatsetuperror": [[1, "kiwi.exceptions.KiwiDiskFormatSetupError", false]], "kiwidiskgeometryerror": [[1, "kiwi.exceptions.KiwiDiskGeometryError", false]], "kiwidistributionnameerror": [[1, "kiwi.exceptions.KiwiDistributionNameError", false]], "kiwienclavebootimageerror": [[1, "kiwi.exceptions.KiwiEnclaveBootImageError", false]], "kiwienclaveformaterror": [[1, "kiwi.exceptions.KiwiEnclaveFormatError", false]], "kiwierror": [[1, "kiwi.exceptions.KiwiError", false]], "kiwiextensionerror": [[1, "kiwi.exceptions.KiwiExtensionError", false]], "kiwifileaccesserror": [[1, "kiwi.exceptions.KiwiFileAccessError", false]], "kiwifilenotfound": [[1, "kiwi.exceptions.KiwiFileNotFound", false]], "kiwifilesystemsetuperror": [[1, "kiwi.exceptions.KiwiFileSystemSetupError", false]], "kiwifilesystemsyncerror": [[1, "kiwi.exceptions.KiwiFileSystemSyncError", false]], "kiwiformatsetuperror": [[1, "kiwi.exceptions.KiwiFormatSetupError", false]], "kiwihelpnocommandgiven": [[1, "kiwi.exceptions.KiwiHelpNoCommandGiven", false]], "kiwiimageresizeerror": [[1, "kiwi.exceptions.KiwiImageResizeError", false]], "kiwiimportdescriptionerror": [[1, "kiwi.exceptions.KiwiImportDescriptionError", false]], "kiwiincludfilenotfounderror": [[1, "kiwi.exceptions.KiwiIncludFileNotFoundError", false]], "kiwiinstallbootimageerror": [[1, "kiwi.exceptions.KiwiInstallBootImageError", false]], "kiwiinstallmediaerror": [[1, "kiwi.exceptions.KiwiInstallMediaError", false]], "kiwiinstallphasefailed": [[1, "kiwi.exceptions.KiwiInstallPhaseFailed", false]], "kiwiisometadataerror": [[1, "kiwi.exceptions.KiwiIsoMetaDataError", false]], "kiwiisotoolerror": [[1, "kiwi.exceptions.KiwiIsoToolError", false]], "kiwikernellookuperror": [[1, "kiwi.exceptions.KiwiKernelLookupError", false]], "kiwikisbootimageerror": [[1, "kiwi.exceptions.KiwiKisBootImageError", false]], "kiwilivebootimageerror": [[1, "kiwi.exceptions.KiwiLiveBootImageError", false]], "kiwiloadcommandundefined": [[1, "kiwi.exceptions.KiwiLoadCommandUndefined", false]], "kiwilogfilesetupfailed": [[1, "kiwi.exceptions.KiwiLogFileSetupFailed", false]], "kiwilogsocketsetupfailed": [[1, "kiwi.exceptions.KiwiLogSocketSetupFailed", false]], "kiwiloopsetuperror": [[1, "kiwi.exceptions.KiwiLoopSetupError", false]], "kiwilukssetuperror": [[1, "kiwi.exceptions.KiwiLuksSetupError", false]], "kiwimappeddeviceerror": [[1, "kiwi.exceptions.KiwiMappedDeviceError", false]], "kiwimarkupconversionerror": [[1, "kiwi.exceptions.KiwiMarkupConversionError", false]], "kiwimountkernelfilesystemserror": [[1, "kiwi.exceptions.KiwiMountKernelFileSystemsError", false]], "kiwimountshareddirectoryerror": [[1, "kiwi.exceptions.KiwiMountSharedDirectoryError", false]], "kiwinotimplementederror": [[1, "kiwi.exceptions.KiwiNotImplementedError", false]], "kiwiociarchivetoolerror": [[1, "kiwi.exceptions.KiwiOCIArchiveToolError", false]], "kiwioffseterror": [[1, "kiwi.exceptions.KiwiOffsetError", false]], "kiwiosreleaseimporterror": [[1, "kiwi.exceptions.KiwiOSReleaseImportError", false]], "kiwipackagemanagersetuperror": [[1, "kiwi.exceptions.KiwiPackageManagerSetupError", false]], "kiwipackagesdeletephasefailed": [[1, "kiwi.exceptions.KiwiPackagesDeletePhaseFailed", false]], "kiwipartitionergptflagerror": [[1, "kiwi.exceptions.KiwiPartitionerGptFlagError", false]], "kiwipartitionermsdosflagerror": [[1, "kiwi.exceptions.KiwiPartitionerMsDosFlagError", false]], "kiwipartitionersetuperror": [[1, "kiwi.exceptions.KiwiPartitionerSetupError", false]], "kiwipartitiontoosmallerror": [[1, "kiwi.exceptions.KiwiPartitionTooSmallError", false]], "kiwiprivilegeserror": [[1, "kiwi.exceptions.KiwiPrivilegesError", false]], "kiwiprofilenotfound": [[1, "kiwi.exceptions.KiwiProfileNotFound", false]], "kiwiraidsetuperror": [[1, "kiwi.exceptions.KiwiRaidSetupError", false]], "kiwirepositorysetuperror": [[1, "kiwi.exceptions.KiwiRepositorySetupError", false]], "kiwirequestedtypeerror": [[1, "kiwi.exceptions.KiwiRequestedTypeError", false]], "kiwirequesterror": [[1, "kiwi.exceptions.KiwiRequestError", false]], "kiwiresizerawdiskerror": [[1, "kiwi.exceptions.KiwiResizeRawDiskError", false]], "kiwiresulterror": [[1, "kiwi.exceptions.KiwiResultError", false]], "kiwirootdirexists": [[1, "kiwi.exceptions.KiwiRootDirExists", false]], "kiwirootimporterror": [[1, "kiwi.exceptions.KiwiRootImportError", false]], "kiwirootinitcreationerror": [[1, "kiwi.exceptions.KiwiRootInitCreationError", false]], "kiwirpmdirnotremoteerror": [[1, "kiwi.exceptions.KiwiRpmDirNotRemoteError", false]], "kiwiruntimeconfigfileerror": [[1, "kiwi.exceptions.KiwiRuntimeConfigFileError", false]], "kiwiruntimeconfigformaterror": [[1, "kiwi.exceptions.KiwiRuntimeConfigFormatError", false]], "kiwiruntimeerror": [[1, "kiwi.exceptions.KiwiRuntimeError", false]], "kiwisatsolverjoberror": [[1, "kiwi.exceptions.KiwiSatSolverJobError", false]], "kiwisatsolverjobproblems": [[1, "kiwi.exceptions.KiwiSatSolverJobProblems", false]], "kiwisatsolverpluginerror": [[1, "kiwi.exceptions.KiwiSatSolverPluginError", false]], "kiwischemaimporterror": [[1, "kiwi.exceptions.KiwiSchemaImportError", false]], "kiwiscriptfailed": [[1, "kiwi.exceptions.KiwiScriptFailed", false]], "kiwisetupintermediateconfigerror": [[1, "kiwi.exceptions.KiwiSetupIntermediateConfigError", false]], "kiwishellvariablevalueerror": [[1, "kiwi.exceptions.KiwiShellVariableValueError", false]], "kiwisizeerror": [[1, "kiwi.exceptions.KiwiSizeError", false]], "kiwisolverrepositorysetuperror": [[1, "kiwi.exceptions.KiwiSolverRepositorySetupError", false]], "kiwisystemdeletepackagesfailed": [[1, "kiwi.exceptions.KiwiSystemDeletePackagesFailed", false]], "kiwisysteminstallpackagesfailed": [[1, "kiwi.exceptions.KiwiSystemInstallPackagesFailed", false]], "kiwisystemupdatefailed": [[1, "kiwi.exceptions.KiwiSystemUpdateFailed", false]], "kiwitargetdirectorynotfound": [[1, "kiwi.exceptions.KiwiTargetDirectoryNotFound", false]], "kiwitemplateerror": [[1, "kiwi.exceptions.KiwiTemplateError", false]], "kiwitypenotfound": [[1, "kiwi.exceptions.KiwiTypeNotFound", false]], "kiwiumountbusyerror": [[1, "kiwi.exceptions.KiwiUmountBusyError", false]], "kiwiunknownservicename": [[1, "kiwi.exceptions.KiwiUnknownServiceName", false]], "kiwiuriopenerror": [[1, "kiwi.exceptions.KiwiUriOpenError", false]], "kiwiuristyleunknown": [[1, "kiwi.exceptions.KiwiUriStyleUnknown", false]], "kiwiuritypeunknown": [[1, "kiwi.exceptions.KiwiUriTypeUnknown", false]], "kiwivalidationerror": [[1, "kiwi.exceptions.KiwiValidationError", false]], "kiwivhdtagerror": [[1, "kiwi.exceptions.KiwiVhdTagError", false]], "kiwivolumegroupconflict": [[1, "kiwi.exceptions.KiwiVolumeGroupConflict", false]], "kiwivolumemanagersetuperror": [[1, "kiwi.exceptions.KiwiVolumeManagerSetupError", false]], "kiwivolumerootiderror": [[1, "kiwi.exceptions.KiwiVolumeRootIDError", false]], "kiwivolumetoosmallerror": [[1, "kiwi.exceptions.KiwiVolumeTooSmallError", false]], "label (kiwi.xml_state.volume_type attribute)": [[1, "kiwi.xml_state.volume_type.label", false]], "labels (kiwi.container.oci.ociconfig attribute)": [[10, "kiwi.container.oci.OciConfig.labels", false]], "legacy_bios_mode() (kiwi.firmware.firmware method)": [[1, "kiwi.firmware.FirmWare.legacy_bios_mode", false]], "list_iso() (kiwi.iso_tools.base.isotoolsbase method)": [[13, "kiwi.iso_tools.base.IsoToolsBase.list_iso", false]], "liveimagebuilder (class in kiwi.builder.live)": [[9, "kiwi.builder.live.LiveImageBuilder", false]], "load() (kiwi.system.result.result static method)": [[23, "kiwi.system.result.Result.load", false]], "load() (kiwi.xml_description.xmldescription method)": [[1, "kiwi.xml_description.XMLDescription.load", false]], "load_boot_xml_description() (kiwi.boot.image.base.bootimagebase method)": [[4, "kiwi.boot.image.base.BootImageBase.load_boot_xml_description", false]], "load_command (kiwi.xml_state.containert attribute)": [[1, "kiwi.xml_state.ContainerT.load_command", false]], "load_command() (kiwi.cli.cli method)": [[1, "kiwi.cli.Cli.load_command", false]], "load_xml_description() (kiwi.tasks.base.clitask method)": [[24, "kiwi.tasks.base.CliTask.load_xml_description", false]], "logger (class in kiwi.logger)": [[1, "kiwi.logger.Logger", false]], "loggerschedulerfilter (class in kiwi.logger_filter)": [[1, "kiwi.logger_filter.LoggerSchedulerFilter", false]], "loopdevice (class in kiwi.storage.loop_device)": [[20, "kiwi.storage.loop_device.LoopDevice", false]], "luks_root (kiwi.builder.disk.storagemap attribute)": [[9, "kiwi.builder.disk.StorageMap.luks_root", false]], "luksdevice (class in kiwi.storage.luks_device)": [[20, "kiwi.storage.luks_device.LuksDevice", false]], "m (kiwi.system.result.result_name_tags attribute)": [[23, "kiwi.system.result.result_name_tags.M", false], [23, "kiwi.system.result.result_name_tags.m", false]], "main() (in module kiwi.kiwi)": [[1, "kiwi.kiwi.main", false]], "maintainer (kiwi.container.oci.ociconfig attribute)": [[10, "kiwi.container.oci.OciConfig.maintainer", false]], "map_partitions() (kiwi.storage.disk.disk method)": [[20, "kiwi.storage.disk.Disk.map_partitions", false]], "mappeddevice (class in kiwi.storage.mapped_device)": [[20, "kiwi.storage.mapped_device.MappedDevice", false]], "match_package_deleted() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.match_package_deleted", false]], "match_package_deleted() (kiwi.package_manager.dnf4.packagemanagerdnf4 method)": [[14, "kiwi.package_manager.dnf4.PackageManagerDnf4.match_package_deleted", false]], "match_package_deleted() (kiwi.package_manager.zypper.packagemanagerzypper method)": [[14, "kiwi.package_manager.zypper.PackageManagerZypper.match_package_deleted", false]], "match_package_installed() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.match_package_installed", false]], "match_package_installed() (kiwi.package_manager.dnf4.packagemanagerdnf4 method)": [[14, "kiwi.package_manager.dnf4.PackageManagerDnf4.match_package_installed", false]], "match_package_installed() (kiwi.package_manager.zypper.packagemanagerzypper method)": [[14, "kiwi.package_manager.zypper.PackageManagerZypper.match_package_installed", false]], "matches() (kiwi.utils.checksum.checksum method)": [[25, "kiwi.utils.checksum.Checksum.matches", false]], "mb (kiwi.defaults.unit_type attribute)": [[1, "kiwi.defaults.unit_type.mb", false]], "mbsize (kiwi.storage.disk.ptable_entry_type attribute)": [[20, "kiwi.storage.disk.ptable_entry_type.mbsize", false]], "mbytes (kiwi.xml_state.size_type attribute)": [[1, "kiwi.xml_state.size_type.mbytes", false]], "md5() (kiwi.utils.checksum.checksum method)": [[25, "kiwi.utils.checksum.Checksum.md5", false]], "min_version (kiwi.runtime_checker.dracut_module_type attribute)": [[1, "kiwi.runtime_checker.dracut_module_type.min_version", false]], "module": [[1, "module-kiwi", false], [1, "module-kiwi.app", false], [1, "module-kiwi.cli", false], [1, "module-kiwi.command", false], [1, "module-kiwi.command_process", false], [1, "module-kiwi.defaults", false], [1, "module-kiwi.exceptions", false], [1, "module-kiwi.firmware", false], [1, "module-kiwi.help", false], [1, "module-kiwi.kiwi", false], [1, "module-kiwi.logger", false], [1, "module-kiwi.logger_color_formatter", false], [1, "module-kiwi.logger_filter", false], [1, "module-kiwi.mount_manager", false], [1, "module-kiwi.path", false], [1, "module-kiwi.privileges", false], [1, "module-kiwi.runtime_checker", false], [1, "module-kiwi.runtime_config", false], [1, "module-kiwi.version", false], [1, "module-kiwi.xml_description", false], [1, "module-kiwi.xml_state", false], [2, "module-kiwi.archive", false], [2, "module-kiwi.archive.cpio", false], [2, "module-kiwi.archive.tar", false], [3, "module-kiwi.boot", false], [4, "module-kiwi.boot.image", false], [4, "module-kiwi.boot.image.base", false], [4, "module-kiwi.boot.image.builtin_kiwi", false], [4, "module-kiwi.boot.image.dracut", false], [5, "module-kiwi.bootloader", false], [6, "module-kiwi.bootloader.config", false], [6, "module-kiwi.bootloader.config.base", false], [6, "module-kiwi.bootloader.config.grub2", false], [6, "module-kiwi.bootloader.config.systemd_boot", false], [6, "module-kiwi.bootloader.config.zipl", false], [7, "module-kiwi.bootloader.install", false], [7, "module-kiwi.bootloader.install.base", false], [7, "module-kiwi.bootloader.install.grub2", false], [7, "module-kiwi.bootloader.install.systemd_boot", false], [7, "module-kiwi.bootloader.install.zipl", false], [8, "module-kiwi.bootloader.template", false], [8, "module-kiwi.bootloader.template.grub2", false], [9, "module-kiwi.builder", false], [9, "module-kiwi.builder.archive", false], [9, "module-kiwi.builder.container", false], [9, "module-kiwi.builder.disk", false], [9, "module-kiwi.builder.filesystem", false], [9, "module-kiwi.builder.install", false], [9, "module-kiwi.builder.kis", false], [9, "module-kiwi.builder.live", false], [10, "module-kiwi.container", false], [10, "module-kiwi.container.oci", false], [11, "module-kiwi.container.setup", false], [11, "module-kiwi.container.setup.base", false], [11, "module-kiwi.container.setup.docker", false], [12, "module-kiwi.filesystem", false], [12, "module-kiwi.filesystem.base", false], [12, "module-kiwi.filesystem.btrfs", false], [12, "module-kiwi.filesystem.ext2", false], [12, "module-kiwi.filesystem.ext3", false], [12, "module-kiwi.filesystem.ext4", false], [12, "module-kiwi.filesystem.fat16", false], [12, "module-kiwi.filesystem.fat32", false], [12, "module-kiwi.filesystem.isofs", false], [12, "module-kiwi.filesystem.setup", false], [12, "module-kiwi.filesystem.squashfs", false], [12, "module-kiwi.filesystem.xfs", false], [13, "module-kiwi.iso_tools", false], [13, "module-kiwi.iso_tools.base", false], [13, "module-kiwi.iso_tools.iso", false], [13, "module-kiwi.iso_tools.xorriso", false], [14, "module-kiwi.package_manager", false], [14, "module-kiwi.package_manager.base", false], [14, "module-kiwi.package_manager.dnf4", false], [14, "module-kiwi.package_manager.zypper", false], [15, "module-kiwi.partitioner", false], [15, "module-kiwi.partitioner.base", false], [15, "module-kiwi.partitioner.dasd", false], [15, "module-kiwi.partitioner.gpt", false], [15, "module-kiwi.partitioner.msdos", false], [16, "module-kiwi.repository", false], [16, "module-kiwi.repository.base", false], [16, "module-kiwi.repository.dnf4", false], [16, "module-kiwi.repository.zypper", false], [17, "module-kiwi.repository.template", false], [17, "module-kiwi.repository.template.apt", false], [18, "module-kiwi.solver", false], [18, "module-kiwi.solver.sat", false], [19, "module-kiwi.solver.repository", false], [19, "module-kiwi.solver.repository.base", false], [19, "module-kiwi.solver.repository.rpm_dir", false], [19, "module-kiwi.solver.repository.rpm_md", false], [19, "module-kiwi.solver.repository.suse", false], [20, "module-kiwi.storage", false], [20, "module-kiwi.storage.clone_device", false], [20, "module-kiwi.storage.device_provider", false], [20, "module-kiwi.storage.disk", false], [20, "module-kiwi.storage.loop_device", false], [20, "module-kiwi.storage.luks_device", false], [20, "module-kiwi.storage.mapped_device", false], [20, "module-kiwi.storage.raid_device", false], [20, "module-kiwi.storage.setup", false], [21, "module-kiwi.storage.subformat", false], [21, "module-kiwi.storage.subformat.base", false], [21, "module-kiwi.storage.subformat.gce", false], [21, "module-kiwi.storage.subformat.ova", false], [21, "module-kiwi.storage.subformat.qcow2", false], [21, "module-kiwi.storage.subformat.vagrant_base", false], [21, "module-kiwi.storage.subformat.vagrant_libvirt", false], [21, "module-kiwi.storage.subformat.vagrant_virtualbox", false], [21, "module-kiwi.storage.subformat.vdi", false], [21, "module-kiwi.storage.subformat.vhd", false], [21, "module-kiwi.storage.subformat.vhdfixed", false], [21, "module-kiwi.storage.subformat.vhdx", false], [21, "module-kiwi.storage.subformat.vmdk", false], [22, "module-kiwi.storage.subformat.template", false], [22, "module-kiwi.storage.subformat.template.vagrant_config", false], [22, "module-kiwi.storage.subformat.template.virtualbox_ovf", false], [22, "module-kiwi.storage.subformat.template.vmware_settings", false], [23, "module-kiwi.system", false], [23, "module-kiwi.system.identifier", false], [23, "module-kiwi.system.kernel", false], [23, "module-kiwi.system.prepare", false], [23, "module-kiwi.system.profile", false], [23, "module-kiwi.system.result", false], [23, "module-kiwi.system.root_bind", false], [23, "module-kiwi.system.root_init", false], [23, "module-kiwi.system.setup", false], [23, "module-kiwi.system.shell", false], [23, "module-kiwi.system.size", false], [23, "module-kiwi.system.uri", false], [23, "module-kiwi.system.users", false], [24, "module-kiwi.tasks", false], [24, "module-kiwi.tasks.base", false], [24, "module-kiwi.tasks.result_bundle", false], [24, "module-kiwi.tasks.result_list", false], [24, "module-kiwi.tasks.system_build", false], [24, "module-kiwi.tasks.system_create", false], [24, "module-kiwi.tasks.system_prepare", false], [24, "module-kiwi.tasks.system_update", false], [25, "module-kiwi.utils", false], [25, "module-kiwi.utils.block", false], [25, "module-kiwi.utils.checksum", false], [25, "module-kiwi.utils.compress", false], [25, "module-kiwi.utils.sync", false], [25, "module-kiwi.utils.sysconfig", false], [26, "module-kiwi.volume_manager", false], [26, "module-kiwi.volume_manager.base", false], [26, "module-kiwi.volume_manager.btrfs", false], [26, "module-kiwi.volume_manager.lvm", false]], "mount() (kiwi.filesystem.base.filesystembase method)": [[12, "kiwi.filesystem.base.FileSystemBase.mount", false]], "mount() (kiwi.mount_manager.mountmanager method)": [[1, "kiwi.mount_manager.MountManager.mount", false]], "mount() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.mount", false]], "mount_kernel_file_systems() (kiwi.system.root_bind.rootbind method)": [[23, "kiwi.system.root_bind.RootBind.mount_kernel_file_systems", false]], "mount_list (kiwi.volume_manager.base.volumemanagerbase attribute)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.mount_list", false]], "mount_shared_directory() (kiwi.system.root_bind.rootbind method)": [[23, "kiwi.system.root_bind.RootBind.mount_shared_directory", false]], "mount_volumes() (kiwi.filesystem.base.filesystembase method)": [[12, "kiwi.filesystem.base.FileSystemBase.mount_volumes", false]], "mount_volumes() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.mount_volumes", false]], "mount_volumes() (kiwi.volume_manager.btrfs.volumemanagerbtrfs method)": [[26, "kiwi.volume_manager.btrfs.VolumeManagerBtrfs.mount_volumes", false]], "mount_volumes() (kiwi.volume_manager.lvm.volumemanagerlvm method)": [[26, "kiwi.volume_manager.lvm.VolumeManagerLVM.mount_volumes", false]], "mountmanager (class in kiwi.mount_manager)": [[1, "kiwi.mount_manager.MountManager", false]], "mountpoint (kiwi.storage.disk.ptable_entry_type attribute)": [[20, "kiwi.storage.disk.ptable_entry_type.mountpoint", false]], "mountpoint (kiwi.volume_manager.base.volumemanagerbase attribute)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.mountpoint", false]], "mountpoint (kiwi.xml_state.volume_type attribute)": [[1, "kiwi.xml_state.volume_type.mountpoint", false]], "move_to_root() (kiwi.path.path static method)": [[1, "kiwi.path.Path.move_to_root", false]], "n (kiwi.system.result.result_name_tags attribute)": [[23, "kiwi.system.result.result_name_tags.N", false]], "name (kiwi.system.kernel.kernel_type attribute)": [[23, "kiwi.system.kernel.kernel_type.name", false]], "name (kiwi.system.kernel.xen_hypervisor_type attribute)": [[23, "kiwi.system.kernel.xen_hypervisor_type.name", false]], "name (kiwi.xml_state.containert attribute)": [[1, "kiwi.xml_state.ContainerT.name", false]], "name (kiwi.xml_state.volume_type attribute)": [[1, "kiwi.xml_state.volume_type.name", false]], "need_boot_partition() (kiwi.storage.setup.disksetup method)": [[20, "kiwi.storage.setup.DiskSetup.need_boot_partition", false]], "new() (kiwi.boot.image.bootimage static method)": [[4, "kiwi.boot.image.BootImage.new", false]], "new() (kiwi.bootloader.install.bootloaderinstall static method)": [[7, "kiwi.bootloader.install.BootLoaderInstall.new", false]], "new() (kiwi.builder.imagebuilder static method)": [[9, "kiwi.builder.ImageBuilder.new", false]], "new() (kiwi.container.containerimage static method)": [[10, "kiwi.container.ContainerImage.new", false]], "new() (kiwi.container.setup.containersetup static method)": [[11, "kiwi.container.setup.ContainerSetup.new", false]], "new() (kiwi.filesystem.filesystem static method)": [[12, "kiwi.filesystem.FileSystem.new", false]], "new() (kiwi.iso_tools.isotools static method)": [[13, "kiwi.iso_tools.IsoTools.new", false]], "new() (kiwi.package_manager.packagemanager static method)": [[14, "kiwi.package_manager.PackageManager.new", false]], "new() (kiwi.partitioner.partitioner static method)": [[15, "kiwi.partitioner.Partitioner.new", false]], "new() (kiwi.repository.repository static method)": [[16, "kiwi.repository.Repository.new", false]], "new() (kiwi.solver.repository.solverrepository static method)": [[19, "kiwi.solver.repository.SolverRepository.new", false]], "new() (kiwi.storage.subformat.diskformat static method)": [[21, "kiwi.storage.subformat.DiskFormat.new", false]], "new() (kiwi.volume_manager.volumemanager static method)": [[26, "kiwi.volume_manager.VolumeManager.new", false]], "ociconfig (class in kiwi.container.oci)": [[10, "kiwi.container.oci.OciConfig", false]], "ofw_mode() (kiwi.firmware.firmware method)": [[1, "kiwi.firmware.FirmWare.ofw_mode", false]], "omit_module() (kiwi.boot.image.base.bootimagebase method)": [[4, "kiwi.boot.image.base.BootImageBase.omit_module", false]], "omit_module() (kiwi.boot.image.dracut.bootimagedracut method)": [[4, "kiwi.boot.image.dracut.BootImageDracut.omit_module", false]], "opal_mode() (kiwi.firmware.firmware method)": [[1, "kiwi.firmware.FirmWare.opal_mode", false]], "output (kiwi.command.commandcallt attribute)": [[1, "kiwi.command.CommandCallT.output", false]], "output (kiwi.command.commandt attribute)": [[1, "kiwi.command.CommandT.output", false]], "output_available (kiwi.command.commandcallt attribute)": [[1, "kiwi.command.CommandCallT.output_available", false]], "overlay_mount() (kiwi.mount_manager.mountmanager method)": [[1, "kiwi.mount_manager.MountManager.overlay_mount", false]], "owner (kiwi.xml_state.filet attribute)": [[1, "kiwi.xml_state.FileT.owner", false]], "p (kiwi.system.result.result_name_tags attribute)": [[23, "kiwi.system.result.result_name_tags.P", false], [23, "kiwi.system.result.result_name_tags.p", false]], "package (kiwi.runtime_checker.dracut_module_type attribute)": [[1, "kiwi.runtime_checker.dracut_module_type.package", false]], "package_matches_host_architecture() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.package_matches_host_architecture", false]], "package_section (kiwi.xml_state.package_type attribute)": [[1, "kiwi.xml_state.package_type.package_section", false]], "package_type (class in kiwi.xml_state)": [[1, "kiwi.xml_state.package_type", false]], "packagemanager (class in kiwi.package_manager)": [[14, "kiwi.package_manager.PackageManager", false]], "packagemanagerbase (class in kiwi.package_manager.base)": [[14, "kiwi.package_manager.base.PackageManagerBase", false]], "packagemanagerdnf4 (class in kiwi.package_manager.dnf4)": [[14, "kiwi.package_manager.dnf4.PackageManagerDnf4", false]], "packagemanagertemplateaptget (class in kiwi.repository.template.apt)": [[17, "kiwi.repository.template.apt.PackageManagerTemplateAptGet", false]], "packagemanagerzypper (class in kiwi.package_manager.zypper)": [[14, "kiwi.package_manager.zypper.PackageManagerZypper", false]], "packages_section (kiwi.xml_state.package_type attribute)": [[1, "kiwi.xml_state.package_type.packages_section", false]], "parent (kiwi.xml_state.volume_type attribute)": [[1, "kiwi.xml_state.volume_type.parent", false]], "partition_name (kiwi.storage.disk.ptable_entry_type attribute)": [[20, "kiwi.storage.disk.ptable_entry_type.partition_name", false]], "partition_type (kiwi.storage.disk.ptable_entry_type attribute)": [[20, "kiwi.storage.disk.ptable_entry_type.partition_type", false]], "partitioner (class in kiwi.partitioner)": [[15, "kiwi.partitioner.Partitioner", false]], "partitionerbase (class in kiwi.partitioner.base)": [[15, "kiwi.partitioner.base.PartitionerBase", false]], "partitionerdasd (class in kiwi.partitioner.dasd)": [[15, "kiwi.partitioner.dasd.PartitionerDasd", false]], "partitionergpt (class in kiwi.partitioner.gpt)": [[15, "kiwi.partitioner.gpt.PartitionerGpt", false]], "partitionermsdos (class in kiwi.partitioner.msdos)": [[15, "kiwi.partitioner.msdos.PartitionerMsDos", false]], "path (class in kiwi.path)": [[1, "kiwi.path.Path", false]], "permissions (kiwi.xml_state.filet attribute)": [[1, "kiwi.xml_state.FileT.permissions", false]], "pinch_system() (kiwi.system.prepare.systemprepare method)": [[23, "kiwi.system.prepare.SystemPrepare.pinch_system", false]], "poll() (kiwi.command_process.commandprocess method)": [[1, "kiwi.command_process.CommandProcess.poll", false]], "poll_and_watch() (kiwi.command_process.commandprocess method)": [[1, "kiwi.command_process.CommandProcess.poll_and_watch", false]], "poll_show_progress() (kiwi.command_process.commandprocess method)": [[1, "kiwi.command_process.CommandProcess.poll_show_progress", false]], "post_init() (kiwi.boot.image.base.bootimagebase method)": [[4, "kiwi.boot.image.base.BootImageBase.post_init", false]], "post_init() (kiwi.boot.image.builtin_kiwi.bootimagekiwi method)": [[4, "kiwi.boot.image.builtin_kiwi.BootImageKiwi.post_init", false]], "post_init() (kiwi.boot.image.dracut.bootimagedracut method)": [[4, "kiwi.boot.image.dracut.BootImageDracut.post_init", false]], "post_init() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.post_init", false]], "post_init() (kiwi.bootloader.config.grub2.bootloaderconfiggrub2 method)": [[6, "kiwi.bootloader.config.grub2.BootLoaderConfigGrub2.post_init", false]], "post_init() (kiwi.bootloader.install.base.bootloaderinstallbase method)": [[7, "kiwi.bootloader.install.base.BootLoaderInstallBase.post_init", false]], "post_init() (kiwi.bootloader.install.grub2.bootloaderinstallgrub2 method)": [[7, "kiwi.bootloader.install.grub2.BootLoaderInstallGrub2.post_init", false]], "post_init() (kiwi.bootloader.install.systemd_boot.bootloaderinstallsystemdboot method)": [[7, "kiwi.bootloader.install.systemd_boot.BootLoaderInstallSystemdBoot.post_init", false]], "post_init() (kiwi.bootloader.install.zipl.bootloaderinstallzipl method)": [[7, "kiwi.bootloader.install.zipl.BootLoaderInstallZipl.post_init", false]], "post_init() (kiwi.container.setup.base.containersetupbase method)": [[11, "kiwi.container.setup.base.ContainerSetupBase.post_init", false]], "post_init() (kiwi.filesystem.base.filesystembase method)": [[12, "kiwi.filesystem.base.FileSystemBase.post_init", false]], "post_init() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.post_init", false]], "post_init() (kiwi.package_manager.dnf4.packagemanagerdnf4 method)": [[14, "kiwi.package_manager.dnf4.PackageManagerDnf4.post_init", false]], "post_init() (kiwi.package_manager.zypper.packagemanagerzypper method)": [[14, "kiwi.package_manager.zypper.PackageManagerZypper.post_init", false]], "post_init() (kiwi.partitioner.base.partitionerbase method)": [[15, "kiwi.partitioner.base.PartitionerBase.post_init", false]], "post_init() (kiwi.partitioner.dasd.partitionerdasd method)": [[15, "kiwi.partitioner.dasd.PartitionerDasd.post_init", false]], "post_init() (kiwi.partitioner.gpt.partitionergpt method)": [[15, "kiwi.partitioner.gpt.PartitionerGpt.post_init", false]], "post_init() (kiwi.partitioner.msdos.partitionermsdos method)": [[15, "kiwi.partitioner.msdos.PartitionerMsDos.post_init", false]], "post_init() (kiwi.repository.base.repositorybase method)": [[16, "kiwi.repository.base.RepositoryBase.post_init", false]], "post_init() (kiwi.repository.dnf4.repositorydnf4 method)": [[16, "kiwi.repository.dnf4.RepositoryDnf4.post_init", false]], "post_init() (kiwi.repository.zypper.repositoryzypper method)": [[16, "kiwi.repository.zypper.RepositoryZypper.post_init", false]], "post_init() (kiwi.storage.subformat.base.diskformatbase method)": [[21, "kiwi.storage.subformat.base.DiskFormatBase.post_init", false]], "post_init() (kiwi.storage.subformat.gce.diskformatgce method)": [[21, "kiwi.storage.subformat.gce.DiskFormatGce.post_init", false]], "post_init() (kiwi.storage.subformat.ova.diskformatova method)": [[21, "kiwi.storage.subformat.ova.DiskFormatOva.post_init", false]], "post_init() (kiwi.storage.subformat.qcow2.diskformatqcow2 method)": [[21, "kiwi.storage.subformat.qcow2.DiskFormatQcow2.post_init", false]], "post_init() (kiwi.storage.subformat.vagrant_base.diskformatvagrantbase method)": [[21, "kiwi.storage.subformat.vagrant_base.DiskFormatVagrantBase.post_init", false]], "post_init() (kiwi.storage.subformat.vdi.diskformatvdi method)": [[21, "kiwi.storage.subformat.vdi.DiskFormatVdi.post_init", false]], "post_init() (kiwi.storage.subformat.vhd.diskformatvhd method)": [[21, "kiwi.storage.subformat.vhd.DiskFormatVhd.post_init", false]], "post_init() (kiwi.storage.subformat.vhdfixed.diskformatvhdfixed method)": [[21, "kiwi.storage.subformat.vhdfixed.DiskFormatVhdFixed.post_init", false]], "post_init() (kiwi.storage.subformat.vhdx.diskformatvhdx method)": [[21, "kiwi.storage.subformat.vhdx.DiskFormatVhdx.post_init", false]], "post_init() (kiwi.storage.subformat.vmdk.diskformatvmdk method)": [[21, "kiwi.storage.subformat.vmdk.DiskFormatVmdk.post_init", false]], "post_init() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.post_init", false]], "post_init() (kiwi.volume_manager.btrfs.volumemanagerbtrfs method)": [[26, "kiwi.volume_manager.btrfs.VolumeManagerBtrfs.post_init", false]], "post_init() (kiwi.volume_manager.lvm.volumemanagerlvm method)": [[26, "kiwi.volume_manager.lvm.VolumeManagerLVM.post_init", false]], "post_process_delete_requests() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.post_process_delete_requests", false]], "post_process_install_requests_bootstrap() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.post_process_install_requests_bootstrap", false]], "post_process_install_requests_bootstrap() (kiwi.package_manager.dnf4.packagemanagerdnf4 method)": [[14, "kiwi.package_manager.dnf4.PackageManagerDnf4.post_process_install_requests_bootstrap", false]], "post_process_install_requests_bootstrap() (kiwi.package_manager.zypper.packagemanagerzypper method)": [[14, "kiwi.package_manager.zypper.PackageManagerZypper.post_process_install_requests_bootstrap", false]], "preferences_matches_host_architecture() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.preferences_matches_host_architecture", false]], "prepare() (kiwi.boot.image.base.bootimagebase method)": [[4, "kiwi.boot.image.base.BootImageBase.prepare", false]], "prepare() (kiwi.boot.image.builtin_kiwi.bootimagekiwi method)": [[4, "kiwi.boot.image.builtin_kiwi.BootImageKiwi.prepare", false]], "prepare() (kiwi.boot.image.dracut.bootimagedracut method)": [[4, "kiwi.boot.image.dracut.BootImageDracut.prepare", false]], "print_results() (kiwi.system.result.result method)": [[23, "kiwi.system.result.Result.print_results", false]], "print_sensitive() (kiwi.system.uri.uri static method)": [[23, "kiwi.system.uri.Uri.print_sensitive", false]], "privileges (class in kiwi.privileges)": [[1, "kiwi.privileges.Privileges", false]], "process (kiwi.command.commandcallt attribute)": [[1, "kiwi.command.CommandCallT.process", false]], "process() (kiwi.tasks.result_bundle.resultbundletask method)": [[24, "kiwi.tasks.result_bundle.ResultBundleTask.process", false]], "process() (kiwi.tasks.result_list.resultlisttask method)": [[24, "kiwi.tasks.result_list.ResultListTask.process", false]], "process() (kiwi.tasks.system_build.systembuildtask method)": [[24, "kiwi.tasks.system_build.SystemBuildTask.process", false]], "process() (kiwi.tasks.system_create.systemcreatetask method)": [[24, "kiwi.tasks.system_create.SystemCreateTask.process", false]], "process() (kiwi.tasks.system_prepare.systempreparetask method)": [[24, "kiwi.tasks.system_prepare.SystemPrepareTask.process", false]], "process() (kiwi.tasks.system_update.systemupdatetask method)": [[24, "kiwi.tasks.system_update.SystemUpdateTask.process", false]], "process_delete_requests() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.process_delete_requests", false]], "process_delete_requests() (kiwi.package_manager.dnf4.packagemanagerdnf4 method)": [[14, "kiwi.package_manager.dnf4.PackageManagerDnf4.process_delete_requests", false]], "process_delete_requests() (kiwi.package_manager.zypper.packagemanagerzypper method)": [[14, "kiwi.package_manager.zypper.PackageManagerZypper.process_delete_requests", false]], "process_install_requests() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.process_install_requests", false]], "process_install_requests() (kiwi.package_manager.dnf4.packagemanagerdnf4 method)": [[14, "kiwi.package_manager.dnf4.PackageManagerDnf4.process_install_requests", false]], "process_install_requests() (kiwi.package_manager.zypper.packagemanagerzypper method)": [[14, "kiwi.package_manager.zypper.PackageManagerZypper.process_install_requests", false]], "process_install_requests_bootstrap() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.process_install_requests_bootstrap", false]], "process_install_requests_bootstrap() (kiwi.package_manager.dnf4.packagemanagerdnf4 method)": [[14, "kiwi.package_manager.dnf4.PackageManagerDnf4.process_install_requests_bootstrap", false]], "process_install_requests_bootstrap() (kiwi.package_manager.zypper.packagemanagerzypper method)": [[14, "kiwi.package_manager.zypper.PackageManagerZypper.process_install_requests_bootstrap", false]], "process_only_required() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.process_only_required", false]], "process_only_required() (kiwi.package_manager.dnf4.packagemanagerdnf4 method)": [[14, "kiwi.package_manager.dnf4.PackageManagerDnf4.process_only_required", false]], "process_only_required() (kiwi.package_manager.zypper.packagemanagerzypper method)": [[14, "kiwi.package_manager.zypper.PackageManagerZypper.process_only_required", false]], "process_plus_recommended() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.process_plus_recommended", false]], "process_plus_recommended() (kiwi.package_manager.dnf4.packagemanagerdnf4 method)": [[14, "kiwi.package_manager.dnf4.PackageManagerDnf4.process_plus_recommended", false]], "process_plus_recommended() (kiwi.package_manager.zypper.packagemanagerzypper method)": [[14, "kiwi.package_manager.zypper.PackageManagerZypper.process_plus_recommended", false]], "profile (class in kiwi.system.profile)": [[23, "kiwi.system.profile.Profile", false]], "profile_matches_host_architecture() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.profile_matches_host_architecture", false]], "progress() (kiwi.logger.logger static method)": [[1, "kiwi.logger.Logger.progress", false]], "project_file() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.project_file", false]], "protected_map_ids (kiwi.storage.disk.disk attribute)": [[20, "kiwi.storage.disk.Disk.protected_map_ids", false]], "ptable_entry_type (class in kiwi.storage.disk)": [[20, "kiwi.storage.disk.ptable_entry_type", false]], "quadruple_token() (kiwi.tasks.base.clitask method)": [[24, "kiwi.tasks.base.CliTask.quadruple_token", false]], "quote() (kiwi.system.shell.shell static method)": [[23, "kiwi.system.shell.Shell.quote", false]], "quote_key_value_file() (kiwi.system.shell.shell static method)": [[23, "kiwi.system.shell.Shell.quote_key_value_file", false]], "quote_title() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.quote_title", false]], "raid_root (kiwi.builder.disk.storagemap attribute)": [[9, "kiwi.builder.disk.StorageMap.raid_root", false]], "raiddevice (class in kiwi.storage.raid_device)": [[20, "kiwi.storage.raid_device.RaidDevice", false]], "realpath (kiwi.xml_state.volume_type attribute)": [[1, "kiwi.xml_state.volume_type.realpath", false]], "rebase_to_root() (kiwi.path.path static method)": [[1, "kiwi.path.Path.rebase_to_root", false]], "remove_hierarchy() (kiwi.path.path static method)": [[1, "kiwi.path.Path.remove_hierarchy", false]], "repository (class in kiwi.repository)": [[16, "kiwi.repository.Repository", false]], "repository_matches_host_architecture() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.repository_matches_host_architecture", false]], "repositorybase (class in kiwi.repository.base)": [[16, "kiwi.repository.base.RepositoryBase", false]], "repositorydnf4 (class in kiwi.repository.dnf4)": [[16, "kiwi.repository.dnf4.RepositoryDnf4", false]], "repositoryzypper (class in kiwi.repository.zypper)": [[16, "kiwi.repository.zypper.RepositoryZypper", false]], "request_collection() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.request_collection", false]], "request_collection() (kiwi.package_manager.dnf4.packagemanagerdnf4 method)": [[14, "kiwi.package_manager.dnf4.PackageManagerDnf4.request_collection", false]], "request_collection() (kiwi.package_manager.zypper.packagemanagerzypper method)": [[14, "kiwi.package_manager.zypper.PackageManagerZypper.request_collection", false]], "request_package() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.request_package", false]], "request_package() (kiwi.package_manager.dnf4.packagemanagerdnf4 method)": [[14, "kiwi.package_manager.dnf4.PackageManagerDnf4.request_package", false]], "request_package() (kiwi.package_manager.zypper.packagemanagerzypper method)": [[14, "kiwi.package_manager.zypper.PackageManagerZypper.request_package", false]], "request_package_exclusion() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.request_package_exclusion", false]], "request_package_exclusion() (kiwi.package_manager.dnf4.packagemanagerdnf4 method)": [[14, "kiwi.package_manager.dnf4.PackageManagerDnf4.request_package_exclusion", false]], "request_package_exclusion() (kiwi.package_manager.zypper.packagemanagerzypper method)": [[14, "kiwi.package_manager.zypper.PackageManagerZypper.request_package_exclusion", false]], "request_package_lock() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.request_package_lock", false]], "request_product() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.request_product", false]], "request_product() (kiwi.package_manager.dnf4.packagemanagerdnf4 method)": [[14, "kiwi.package_manager.dnf4.PackageManagerDnf4.request_product", false]], "request_product() (kiwi.package_manager.zypper.packagemanagerzypper method)": [[14, "kiwi.package_manager.zypper.PackageManagerZypper.request_product", false]], "resize_raw_disk() (kiwi.storage.subformat.base.diskformatbase method)": [[21, "kiwi.storage.subformat.base.DiskFormatBase.resize_raw_disk", false]], "resize_table() (kiwi.partitioner.base.partitionerbase method)": [[15, "kiwi.partitioner.base.PartitionerBase.resize_table", false]], "resize_table() (kiwi.partitioner.dasd.partitionerdasd method)": [[15, "kiwi.partitioner.dasd.PartitionerDasd.resize_table", false]], "resize_table() (kiwi.partitioner.gpt.partitionergpt method)": [[15, "kiwi.partitioner.gpt.PartitionerGpt.resize_table", false]], "resize_table() (kiwi.partitioner.msdos.partitionermsdos method)": [[15, "kiwi.partitioner.msdos.PartitionerMsDos.resize_table", false]], "resolve_this_path() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.resolve_this_path", false]], "result (class in kiwi.system.result)": [[23, "kiwi.system.result.Result", false]], "result_file_type (class in kiwi.system.result)": [[23, "kiwi.system.result.result_file_type", false]], "result_name_tags (class in kiwi.system.result)": [[23, "kiwi.system.result.result_name_tags", false]], "resultbundletask (class in kiwi.tasks.result_bundle)": [[24, "kiwi.tasks.result_bundle.ResultBundleTask", false]], "resultlisttask (class in kiwi.tasks.result_list)": [[24, "kiwi.tasks.result_list.ResultListTask", false]], "returncode (kiwi.command.commandt attribute)": [[1, "kiwi.command.CommandT.returncode", false]], "returncode() (kiwi.command_process.commandprocess method)": [[1, "kiwi.command_process.CommandProcess.returncode", false]], "root_dir (kiwi.volume_manager.base.volumemanagerbase attribute)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.root_dir", false]], "rootbind (class in kiwi.system.root_bind)": [[23, "kiwi.system.root_bind.RootBind", false]], "rootinit (class in kiwi.system.root_init)": [[23, "kiwi.system.root_init.RootInit", false]], "run() (kiwi.command.command static method)": [[1, "kiwi.command.Command.run", false]], "run_checks() (kiwi.tasks.base.clitask method)": [[24, "kiwi.tasks.base.CliTask.run_checks", false]], "run_common_function() (kiwi.system.shell.shell static method)": [[23, "kiwi.system.shell.Shell.run_common_function", false]], "run_repo_customize() (kiwi.repository.base.repositorybase static method)": [[16, "kiwi.repository.base.RepositoryBase.run_repo_customize", false]], "runtime_config() (kiwi.repository.base.repositorybase method)": [[16, "kiwi.repository.base.RepositoryBase.runtime_config", false]], "runtime_config() (kiwi.repository.dnf4.repositorydnf4 method)": [[16, "kiwi.repository.dnf4.RepositoryDnf4.runtime_config", false]], "runtime_config() (kiwi.repository.zypper.repositoryzypper method)": [[16, "kiwi.repository.zypper.RepositoryZypper.runtime_config", false]], "runtimechecker (class in kiwi.runtime_checker)": [[1, "kiwi.runtime_checker.RuntimeChecker", false]], "runtimeconfig (class in kiwi.runtime_config)": [[1, "kiwi.runtime_config.RuntimeConfig", false]], "sat (class in kiwi.solver.sat)": [[18, "kiwi.solver.sat.Sat", false]], "script_exists() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.script_exists", false]], "secure_boot_install() (kiwi.bootloader.install.base.bootloaderinstallbase method)": [[7, "kiwi.bootloader.install.base.BootLoaderInstallBase.secure_boot_install", false]], "secure_boot_install() (kiwi.bootloader.install.grub2.bootloaderinstallgrub2 method)": [[7, "kiwi.bootloader.install.grub2.BootLoaderInstallGrub2.secure_boot_install", false]], "secure_boot_install() (kiwi.bootloader.install.systemd_boot.bootloaderinstallsystemdboot method)": [[7, "kiwi.bootloader.install.systemd_boot.BootLoaderInstallSystemdBoot.secure_boot_install", false]], "secure_boot_install() (kiwi.bootloader.install.zipl.bootloaderinstallzipl method)": [[7, "kiwi.bootloader.install.zipl.BootLoaderInstallZipl.secure_boot_install", false]], "set_color_format() (kiwi.logger.logger method)": [[1, "kiwi.logger.Logger.set_color_format", false]], "set_container_config_tag() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.set_container_config_tag", false]], "set_custom_runtime_config_file() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.set_custom_runtime_config_file", false]], "set_derived_from_image_uri() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.set_derived_from_image_uri", false]], "set_disk_password() (kiwi.bootloader.install.grub2.bootloaderinstallgrub2 method)": [[7, "kiwi.bootloader.install.grub2.BootLoaderInstallGrub2.set_disk_password", false]], "set_dist_type() (kiwi.solver.sat.sat method)": [[18, "kiwi.solver.sat.Sat.set_dist_type", false]], "set_flag() (kiwi.partitioner.base.partitionerbase method)": [[15, "kiwi.partitioner.base.PartitionerBase.set_flag", false]], "set_flag() (kiwi.partitioner.gpt.partitionergpt method)": [[15, "kiwi.partitioner.gpt.PartitionerGpt.set_flag", false]], "set_flag() (kiwi.partitioner.msdos.partitionermsdos method)": [[15, "kiwi.partitioner.msdos.PartitionerMsDos.set_flag", false]], "set_hybrid_mbr() (kiwi.partitioner.base.partitionerbase method)": [[15, "kiwi.partitioner.base.PartitionerBase.set_hybrid_mbr", false]], "set_hybrid_mbr() (kiwi.partitioner.gpt.partitionergpt method)": [[15, "kiwi.partitioner.gpt.PartitionerGpt.set_hybrid_mbr", false]], "set_loader_entry() (kiwi.bootloader.config.systemd_boot.bootloadersystemdboot method)": [[6, "kiwi.bootloader.config.systemd_boot.BootLoaderSystemdBoot.set_loader_entry", false]], "set_loader_entry() (kiwi.bootloader.config.zipl.bootloaderzipl method)": [[6, "kiwi.bootloader.config.zipl.BootLoaderZipl.set_loader_entry", false]], "set_log_socket() (kiwi.logger.logger method)": [[1, "kiwi.logger.Logger.set_log_socket", false]], "set_logfile() (kiwi.logger.logger method)": [[1, "kiwi.logger.Logger.set_logfile", false]], "set_mbr() (kiwi.partitioner.base.partitionerbase method)": [[15, "kiwi.partitioner.base.PartitionerBase.set_mbr", false]], "set_mbr() (kiwi.partitioner.gpt.partitionergpt method)": [[15, "kiwi.partitioner.gpt.PartitionerGpt.set_mbr", false]], "set_media_tag() (kiwi.iso_tools.iso.iso static method)": [[13, "kiwi.iso_tools.iso.Iso.set_media_tag", false]], "set_platform_name() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.set_platform_name", false]], "set_property_readonly_root() (kiwi.filesystem.base.filesystembase method)": [[12, "kiwi.filesystem.base.FileSystemBase.set_property_readonly_root", false]], "set_property_readonly_root() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.set_property_readonly_root", false]], "set_property_readonly_root() (kiwi.volume_manager.btrfs.volumemanagerbtrfs method)": [[26, "kiwi.volume_manager.btrfs.VolumeManagerBtrfs.set_property_readonly_root", false]], "set_repository() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.set_repository", false]], "set_root_filesystem_uuid() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.set_root_filesystem_uuid", false]], "set_root_partition_uuid() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.set_root_partition_uuid", false]], "set_runtime_checker_metadata() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.set_runtime_checker_metadata", false]], "set_selinux_file_contexts() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.set_selinux_file_contexts", false]], "set_shared_cache_location() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.set_shared_cache_location", false]], "set_start_sector() (kiwi.partitioner.base.partitionerbase method)": [[15, "kiwi.partitioner.base.PartitionerBase.set_start_sector", false]], "set_start_sector() (kiwi.partitioner.msdos.partitionermsdos method)": [[15, "kiwi.partitioner.msdos.PartitionerMsDos.set_start_sector", false]], "set_start_sector() (kiwi.storage.disk.disk method)": [[20, "kiwi.storage.disk.Disk.set_start_sector", false]], "set_static_modules() (kiwi.boot.image.base.bootimagebase method)": [[4, "kiwi.boot.image.base.BootImageBase.set_static_modules", false]], "set_static_modules() (kiwi.boot.image.dracut.bootimagedracut method)": [[4, "kiwi.boot.image.dracut.BootImageDracut.set_static_modules", false]], "set_temp_location() (kiwi.defaults.defaults static method)": [[1, "kiwi.defaults.Defaults.set_temp_location", false]], "set_uuid() (kiwi.filesystem.base.filesystembase method)": [[12, "kiwi.filesystem.base.FileSystemBase.set_uuid", false]], "set_uuid() (kiwi.filesystem.btrfs.filesystembtrfs method)": [[12, "kiwi.filesystem.btrfs.FileSystemBtrfs.set_uuid", false]], "set_uuid() (kiwi.filesystem.ext2.filesystemext2 method)": [[12, "kiwi.filesystem.ext2.FileSystemExt2.set_uuid", false]], "set_uuid() (kiwi.filesystem.ext3.filesystemext3 method)": [[12, "kiwi.filesystem.ext3.FileSystemExt3.set_uuid", false]], "set_uuid() (kiwi.filesystem.ext4.filesystemext4 method)": [[12, "kiwi.filesystem.ext4.FileSystemExt4.set_uuid", false]], "set_uuid() (kiwi.filesystem.fat16.filesystemfat16 method)": [[12, "kiwi.filesystem.fat16.FileSystemFat16.set_uuid", false]], "set_uuid() (kiwi.filesystem.fat32.filesystemfat32 method)": [[12, "kiwi.filesystem.fat32.FileSystemFat32.set_uuid", false]], "set_uuid() (kiwi.filesystem.xfs.filesystemxfs method)": [[12, "kiwi.filesystem.xfs.FileSystemXfs.set_uuid", false]], "set_uuid() (kiwi.partitioner.base.partitionerbase method)": [[15, "kiwi.partitioner.base.PartitionerBase.set_uuid", false]], "set_uuid() (kiwi.partitioner.dasd.partitionerdasd method)": [[15, "kiwi.partitioner.dasd.PartitionerDasd.set_uuid", false]], "set_uuid() (kiwi.partitioner.gpt.partitionergpt method)": [[15, "kiwi.partitioner.gpt.PartitionerGpt.set_uuid", false]], "set_uuid() (kiwi.partitioner.msdos.partitionermsdos method)": [[15, "kiwi.partitioner.msdos.PartitionerMsDos.set_uuid", false]], "setlogflag() (kiwi.logger.logger method)": [[1, "kiwi.logger.Logger.setLogFlag", false]], "setloglevel() (kiwi.logger.logger method)": [[1, "kiwi.logger.Logger.setLogLevel", false]], "setup() (kiwi.container.setup.base.containersetupbase method)": [[11, "kiwi.container.setup.base.ContainerSetupBase.setup", false]], "setup() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.setup", false]], "setup() (kiwi.volume_manager.btrfs.volumemanagerbtrfs method)": [[26, "kiwi.volume_manager.btrfs.VolumeManagerBtrfs.setup", false]], "setup() (kiwi.volume_manager.lvm.volumemanagerlvm method)": [[26, "kiwi.volume_manager.lvm.VolumeManagerLVM.setup", false]], "setup_disk_boot_images() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.setup_disk_boot_images", false]], "setup_disk_boot_images() (kiwi.bootloader.config.grub2.bootloaderconfiggrub2 method)": [[6, "kiwi.bootloader.config.grub2.BootLoaderConfigGrub2.setup_disk_boot_images", false]], "setup_disk_image_config() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.setup_disk_image_config", false]], "setup_disk_image_config() (kiwi.bootloader.config.grub2.bootloaderconfiggrub2 method)": [[6, "kiwi.bootloader.config.grub2.BootLoaderConfigGrub2.setup_disk_image_config", false]], "setup_groups() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.setup_groups", false]], "setup_home_for_user() (kiwi.system.users.users method)": [[23, "kiwi.system.users.Users.setup_home_for_user", false]], "setup_install_boot_images() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.setup_install_boot_images", false]], "setup_install_boot_images() (kiwi.bootloader.config.grub2.bootloaderconfiggrub2 method)": [[6, "kiwi.bootloader.config.grub2.BootLoaderConfigGrub2.setup_install_boot_images", false]], "setup_install_image_config() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.setup_install_image_config", false]], "setup_install_image_config() (kiwi.bootloader.config.grub2.bootloaderconfiggrub2 method)": [[6, "kiwi.bootloader.config.grub2.BootLoaderConfigGrub2.setup_install_image_config", false]], "setup_intermediate_config() (kiwi.system.root_bind.rootbind method)": [[23, "kiwi.system.root_bind.RootBind.setup_intermediate_config", false]], "setup_keyboard_map() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.setup_keyboard_map", false]], "setup_live_boot_images() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.setup_live_boot_images", false]], "setup_live_boot_images() (kiwi.bootloader.config.grub2.bootloaderconfiggrub2 method)": [[6, "kiwi.bootloader.config.grub2.BootLoaderConfigGrub2.setup_live_boot_images", false]], "setup_live_image_config() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.setup_live_image_config", false]], "setup_live_image_config() (kiwi.bootloader.config.grub2.bootloaderconfiggrub2 method)": [[6, "kiwi.bootloader.config.grub2.BootLoaderConfigGrub2.setup_live_image_config", false]], "setup_loader() (kiwi.bootloader.config.systemd_boot.bootloadersystemdboot method)": [[6, "kiwi.bootloader.config.systemd_boot.BootLoaderSystemdBoot.setup_loader", false]], "setup_loader() (kiwi.bootloader.config.zipl.bootloaderzipl method)": [[6, "kiwi.bootloader.config.zipl.BootLoaderZipl.setup_loader", false]], "setup_locale() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.setup_locale", false]], "setup_machine_id() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.setup_machine_id", false]], "setup_media_loader_directory() (kiwi.iso_tools.base.isotoolsbase static method)": [[13, "kiwi.iso_tools.base.IsoToolsBase.setup_media_loader_directory", false]], "setup_mountpoint() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.setup_mountpoint", false]], "setup_package_database_configuration() (kiwi.repository.base.repositorybase method)": [[16, "kiwi.repository.base.RepositoryBase.setup_package_database_configuration", false]], "setup_package_database_configuration() (kiwi.repository.dnf4.repositorydnf4 method)": [[16, "kiwi.repository.dnf4.RepositoryDnf4.setup_package_database_configuration", false]], "setup_package_database_configuration() (kiwi.repository.zypper.repositoryzypper method)": [[16, "kiwi.repository.zypper.RepositoryZypper.setup_package_database_configuration", false]], "setup_permissions() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.setup_permissions", false]], "setup_plymouth_splash() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.setup_plymouth_splash", false]], "setup_registry_import() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.setup_registry_import", false]], "setup_repositories() (kiwi.system.prepare.systemprepare method)": [[23, "kiwi.system.prepare.SystemPrepare.setup_repositories", false]], "setup_repository_modules() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.setup_repository_modules", false]], "setup_repository_modules() (kiwi.package_manager.dnf4.packagemanagerdnf4 method)": [[14, "kiwi.package_manager.dnf4.PackageManagerDnf4.setup_repository_modules", false]], "setup_repository_modules() (kiwi.package_manager.zypper.packagemanagerzypper method)": [[14, "kiwi.package_manager.zypper.PackageManagerZypper.setup_repository_modules", false]], "setup_root_console() (kiwi.container.setup.base.containersetupbase method)": [[11, "kiwi.container.setup.base.ContainerSetupBase.setup_root_console", false]], "setup_selinux_file_contexts() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.setup_selinux_file_contexts", false]], "setup_sysconfig_bootloader() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.setup_sysconfig_bootloader", false]], "setup_sysconfig_bootloader() (kiwi.bootloader.config.grub2.bootloaderconfiggrub2 method)": [[6, "kiwi.bootloader.config.grub2.BootLoaderConfigGrub2.setup_sysconfig_bootloader", false]], "setup_timezone() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.setup_timezone", false]], "setup_users() (kiwi.system.setup.systemsetup method)": [[23, "kiwi.system.setup.SystemSetup.setup_users", false]], "sha256() (kiwi.utils.checksum.checksum method)": [[25, "kiwi.utils.checksum.Checksum.sha256", false]], "shasum (kiwi.system.result.result_file_type attribute)": [[23, "kiwi.system.result.result_file_type.shasum", false]], "shell (class in kiwi.system.shell)": [[23, "kiwi.system.shell.Shell", false]], "shim_loader_type (class in kiwi.defaults)": [[1, "kiwi.defaults.shim_loader_type", false]], "show() (kiwi.help.help method)": [[1, "kiwi.help.Help.show", false]], "show_and_exit_on_help_request() (kiwi.cli.cli method)": [[1, "kiwi.cli.Cli.show_and_exit_on_help_request", false]], "size (kiwi.xml_state.volume_type attribute)": [[1, "kiwi.xml_state.volume_type.size", false]], "size_type (class in kiwi.xml_state)": [[1, "kiwi.xml_state.size_type", false]], "solve() (kiwi.solver.sat.sat method)": [[18, "kiwi.solver.sat.Sat.solve", false]], "solverrepository (class in kiwi.solver.repository)": [[19, "kiwi.solver.repository.SolverRepository", false]], "solverrepositorybase (class in kiwi.solver.repository.base)": [[19, "kiwi.solver.repository.base.SolverRepositoryBase", false]], "solverrepositoryrpmdir (class in kiwi.solver.repository.rpm_dir)": [[19, "kiwi.solver.repository.rpm_dir.SolverRepositoryRpmDir", false]], "solverrepositoryrpmmd (class in kiwi.solver.repository.rpm_md)": [[19, "kiwi.solver.repository.rpm_md.SolverRepositoryRpmMd", false]], "solverrepositorysuse (class in kiwi.solver.repository.suse)": [[19, "kiwi.solver.repository.suse.SolverRepositorySUSE", false]], "sort_by_hierarchy() (kiwi.path.path static method)": [[1, "kiwi.path.Path.sort_by_hierarchy", false]], "specification (kiwi.xml_state.description_type attribute)": [[1, "kiwi.xml_state.description_type.specification", false]], "storage_provider (kiwi.storage.disk.disk attribute)": [[20, "kiwi.storage.disk.Disk.storage_provider", false]], "storage_provider (kiwi.storage.luks_device.luksdevice attribute)": [[20, "kiwi.storage.luks_device.LuksDevice.storage_provider", false]], "storage_provider (kiwi.storage.raid_device.raiddevice attribute)": [[20, "kiwi.storage.raid_device.RaidDevice.storage_provider", false]], "storagemap (class in kiwi.builder.disk)": [[9, "kiwi.builder.disk.StorageMap", false]], "store_to_result() (kiwi.storage.subformat.base.diskformatbase method)": [[21, "kiwi.storage.subformat.base.DiskFormatBase.store_to_result", false]], "store_to_result() (kiwi.storage.subformat.gce.diskformatgce method)": [[21, "kiwi.storage.subformat.gce.DiskFormatGce.store_to_result", false]], "store_to_result() (kiwi.storage.subformat.ova.diskformatova method)": [[21, "kiwi.storage.subformat.ova.DiskFormatOva.store_to_result", false]], "store_to_result() (kiwi.storage.subformat.qcow2.diskformatqcow2 method)": [[21, "kiwi.storage.subformat.qcow2.DiskFormatQcow2.store_to_result", false]], "store_to_result() (kiwi.storage.subformat.vagrant_base.diskformatvagrantbase method)": [[21, "kiwi.storage.subformat.vagrant_base.DiskFormatVagrantBase.store_to_result", false]], "store_to_result() (kiwi.storage.subformat.vhdfixed.diskformatvhdfixed method)": [[21, "kiwi.storage.subformat.vhdfixed.DiskFormatVhdFixed.store_to_result", false]], "store_to_result() (kiwi.storage.subformat.vmdk.diskformatvmdk method)": [[21, "kiwi.storage.subformat.vmdk.DiskFormatVmdk.store_to_result", false]], "sync_data() (kiwi.filesystem.base.filesystembase method)": [[12, "kiwi.filesystem.base.FileSystemBase.sync_data", false]], "sync_data() (kiwi.utils.sync.datasync method)": [[25, "kiwi.utils.sync.DataSync.sync_data", false]], "sync_data() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.sync_data", false]], "sync_data() (kiwi.volume_manager.btrfs.volumemanagerbtrfs method)": [[26, "kiwi.volume_manager.btrfs.VolumeManagerBtrfs.sync_data", false]], "sysconfig (class in kiwi.utils.sysconfig)": [[25, "kiwi.utils.sysconfig.SysConfig", false]], "system (kiwi.builder.disk.storagemap attribute)": [[9, "kiwi.builder.disk.StorageMap.system", false]], "system_boot (kiwi.builder.disk.storagemap attribute)": [[9, "kiwi.builder.disk.StorageMap.system_boot", false]], "system_custom_parts (kiwi.builder.disk.storagemap attribute)": [[9, "kiwi.builder.disk.StorageMap.system_custom_parts", false]], "system_efi (kiwi.builder.disk.storagemap attribute)": [[9, "kiwi.builder.disk.StorageMap.system_efi", false]], "system_spare (kiwi.builder.disk.storagemap attribute)": [[9, "kiwi.builder.disk.StorageMap.system_spare", false]], "systembuildtask (class in kiwi.tasks.system_build)": [[24, "kiwi.tasks.system_build.SystemBuildTask", false]], "systemcreatetask (class in kiwi.tasks.system_create)": [[24, "kiwi.tasks.system_create.SystemCreateTask", false]], "systemidentifier (class in kiwi.system.identifier)": [[23, "kiwi.system.identifier.SystemIdentifier", false]], "systemprepare (class in kiwi.system.prepare)": [[23, "kiwi.system.prepare.SystemPrepare", false]], "systempreparetask (class in kiwi.tasks.system_prepare)": [[24, "kiwi.tasks.system_prepare.SystemPrepareTask", false]], "systemsetup (class in kiwi.system.setup)": [[23, "kiwi.system.setup.SystemSetup", false]], "systemsize (class in kiwi.system.size)": [[23, "kiwi.system.size.SystemSize", false]], "systemupdatetask (class in kiwi.tasks.system_update)": [[24, "kiwi.tasks.system_update.SystemUpdateTask", false]], "t (kiwi.system.result.result_name_tags attribute)": [[23, "kiwi.system.result.result_name_tags.T", false]], "target (kiwi.xml_state.filet attribute)": [[1, "kiwi.xml_state.FileT.target", false]], "target_supports_extended_attributes() (kiwi.utils.sync.datasync method)": [[25, "kiwi.utils.sync.DataSync.target_supports_extended_attributes", false]], "tentuple_token() (kiwi.tasks.base.clitask method)": [[24, "kiwi.tasks.base.CliTask.tentuple_token", false]], "timestamp() (kiwi.solver.repository.base.solverrepositorybase method)": [[19, "kiwi.solver.repository.base.SolverRepositoryBase.timestamp", false]], "timestamp() (kiwi.solver.repository.rpm_md.solverrepositoryrpmmd method)": [[19, "kiwi.solver.repository.rpm_md.SolverRepositoryRpmMd.timestamp", false]], "tmpfs_mount() (kiwi.mount_manager.mountmanager method)": [[1, "kiwi.mount_manager.MountManager.tmpfs_mount", false]], "to_profile() (kiwi.defaults.defaults method)": [[1, "kiwi.defaults.Defaults.to_profile", false]], "translate() (kiwi.system.uri.uri method)": [[23, "kiwi.system.uri.Uri.translate", false]], "umount() (kiwi.filesystem.base.filesystembase method)": [[12, "kiwi.filesystem.base.FileSystemBase.umount", false]], "umount() (kiwi.mount_manager.mountmanager method)": [[1, "kiwi.mount_manager.MountManager.umount", false]], "umount() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.umount", false]], "umount_kernel_file_systems() (kiwi.system.root_bind.rootbind method)": [[23, "kiwi.system.root_bind.RootBind.umount_kernel_file_systems", false]], "umount_lazy() (kiwi.mount_manager.mountmanager method)": [[1, "kiwi.mount_manager.MountManager.umount_lazy", false]], "umount_volumes() (kiwi.filesystem.base.filesystembase method)": [[12, "kiwi.filesystem.base.FileSystemBase.umount_volumes", false]], "umount_volumes() (kiwi.volume_manager.base.volumemanagerbase method)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.umount_volumes", false]], "umount_volumes() (kiwi.volume_manager.btrfs.volumemanagerbtrfs method)": [[26, "kiwi.volume_manager.btrfs.VolumeManagerBtrfs.umount_volumes", false]], "umount_volumes() (kiwi.volume_manager.lvm.volumemanagerlvm method)": [[26, "kiwi.volume_manager.lvm.VolumeManagerLVM.umount_volumes", false]], "uncompress() (kiwi.utils.compress.compress method)": [[25, "kiwi.utils.compress.Compress.uncompress", false]], "unit_type (class in kiwi.defaults)": [[1, "kiwi.defaults.unit_type", false]], "update() (kiwi.package_manager.base.packagemanagerbase method)": [[14, "kiwi.package_manager.base.PackageManagerBase.update", false]], "update() (kiwi.package_manager.dnf4.packagemanagerdnf4 method)": [[14, "kiwi.package_manager.dnf4.PackageManagerDnf4.update", false]], "update() (kiwi.package_manager.zypper.packagemanagerzypper method)": [[14, "kiwi.package_manager.zypper.PackageManagerZypper.update", false]], "update_system() (kiwi.system.prepare.systemprepare method)": [[23, "kiwi.system.prepare.SystemPrepare.update_system", false]], "uri (class in kiwi.system.uri)": [[23, "kiwi.system.uri.Uri", false]], "uri_list (kiwi.system.prepare.systemprepare attribute)": [[23, "kiwi.system.prepare.SystemPrepare.uri_list", false]], "usage() (in module kiwi.kiwi)": [[1, "kiwi.kiwi.usage", false]], "use_default_location() (kiwi.repository.base.repositorybase method)": [[16, "kiwi.repository.base.RepositoryBase.use_default_location", false]], "use_default_location() (kiwi.repository.dnf4.repositorydnf4 method)": [[16, "kiwi.repository.dnf4.RepositoryDnf4.use_default_location", false]], "use_default_location() (kiwi.repository.zypper.repositoryzypper method)": [[16, "kiwi.repository.zypper.RepositoryZypper.use_default_location", false]], "use_for_bundle (kiwi.system.result.result_file_type attribute)": [[23, "kiwi.system.result.result_file_type.use_for_bundle", false]], "user (kiwi.container.oci.ociconfig attribute)": [[10, "kiwi.container.oci.OciConfig.user", false]], "user_add() (kiwi.system.users.users method)": [[23, "kiwi.system.users.Users.user_add", false]], "user_exists() (kiwi.system.users.users method)": [[23, "kiwi.system.users.Users.user_exists", false]], "user_modify() (kiwi.system.users.users method)": [[23, "kiwi.system.users.Users.user_modify", false]], "users (class in kiwi.system.users)": [[23, "kiwi.system.users.Users", false]], "v (kiwi.system.result.result_name_tags attribute)": [[23, "kiwi.system.result.result_name_tags.v", false]], "vagrant_post_init() (kiwi.storage.subformat.vagrant_base.diskformatvagrantbase method)": [[21, "kiwi.storage.subformat.vagrant_base.DiskFormatVagrantBase.vagrant_post_init", false]], "vagrant_post_init() (kiwi.storage.subformat.vagrant_libvirt.diskformatvagrantlibvirt method)": [[21, "kiwi.storage.subformat.vagrant_libvirt.DiskFormatVagrantLibVirt.vagrant_post_init", false]], "vagrant_post_init() (kiwi.storage.subformat.vagrant_virtualbox.diskformatvagrantvirtualbox method)": [[21, "kiwi.storage.subformat.vagrant_virtualbox.DiskFormatVagrantVirtualBox.vagrant_post_init", false]], "vagrantconfigtemplate (class in kiwi.storage.subformat.template.vagrant_config)": [[22, "kiwi.storage.subformat.template.vagrant_config.VagrantConfigTemplate", false]], "verify_image_size() (kiwi.system.result.result static method)": [[23, "kiwi.system.result.Result.verify_image_size", false]], "version (kiwi.system.kernel.kernel_type attribute)": [[23, "kiwi.system.kernel.kernel_type.version", false]], "virtualboxovftemplate (class in kiwi.storage.subformat.template.virtualbox_ovf)": [[22, "kiwi.storage.subformat.template.virtualbox_ovf.VirtualboxOvfTemplate", false]], "vmwaresettingstemplate (class in kiwi.storage.subformat.template.vmware_settings)": [[22, "kiwi.storage.subformat.template.vmware_settings.VmwareSettingsTemplate", false]], "volume_group (kiwi.volume_manager.base.volumemanagerbase attribute)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.volume_group", false]], "volume_map (kiwi.volume_manager.base.volumemanagerbase attribute)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.volume_map", false]], "volume_matches_host_architecture() (kiwi.xml_state.xmlstate method)": [[1, "kiwi.xml_state.XMLState.volume_matches_host_architecture", false]], "volume_type (class in kiwi.xml_state)": [[1, "kiwi.xml_state.volume_type", false]], "volumemanager (class in kiwi.volume_manager)": [[26, "kiwi.volume_manager.VolumeManager", false]], "volumemanagerbase (class in kiwi.volume_manager.base)": [[26, "kiwi.volume_manager.base.VolumeManagerBase", false]], "volumemanagerbtrfs (class in kiwi.volume_manager.btrfs)": [[26, "kiwi.volume_manager.btrfs.VolumeManagerBtrfs", false]], "volumemanagerlvm (class in kiwi.volume_manager.lvm)": [[26, "kiwi.volume_manager.lvm.VolumeManagerLVM", false]], "volumes (kiwi.container.oci.ociconfig attribute)": [[10, "kiwi.container.oci.OciConfig.volumes", false]], "volumes (kiwi.volume_manager.base.volumemanagerbase attribute)": [[26, "kiwi.volume_manager.base.VolumeManagerBase.volumes", false]], "warningfilter (class in kiwi.logger_filter)": [[1, "kiwi.logger_filter.WarningFilter", false]], "which() (kiwi.path.path static method)": [[1, "kiwi.path.Path.which", false]], "wipe() (kiwi.path.path static method)": [[1, "kiwi.path.Path.wipe", false]], "wipe() (kiwi.storage.disk.disk method)": [[20, "kiwi.storage.disk.Disk.wipe", false]], "workingdir (kiwi.container.oci.ociconfig attribute)": [[10, "kiwi.container.oci.OciConfig.workingdir", false]], "write() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.write", false]], "write() (kiwi.bootloader.config.grub2.bootloaderconfiggrub2 method)": [[6, "kiwi.bootloader.config.grub2.BootLoaderConfigGrub2.write", false]], "write() (kiwi.system.identifier.systemidentifier method)": [[23, "kiwi.system.identifier.SystemIdentifier.write", false]], "write() (kiwi.utils.sysconfig.sysconfig method)": [[25, "kiwi.utils.sysconfig.SysConfig.write", false]], "write_meta_data() (kiwi.bootloader.config.base.bootloaderconfigbase method)": [[6, "kiwi.bootloader.config.base.BootLoaderConfigBase.write_meta_data", false]], "write_meta_data() (kiwi.bootloader.config.grub2.bootloaderconfiggrub2 method)": [[6, "kiwi.bootloader.config.grub2.BootLoaderConfigGrub2.write_meta_data", false]], "write_system_config_file() (kiwi.boot.image.base.bootimagebase method)": [[4, "kiwi.boot.image.base.BootImageBase.write_system_config_file", false]], "write_system_config_file() (kiwi.boot.image.dracut.bootimagedracut method)": [[4, "kiwi.boot.image.dracut.BootImageDracut.write_system_config_file", false]], "write_to_disk() (kiwi.system.identifier.systemidentifier method)": [[23, "kiwi.system.identifier.SystemIdentifier.write_to_disk", false]], "xen_hypervisor_type (class in kiwi.system.kernel)": [[23, "kiwi.system.kernel.xen_hypervisor_type", false]], "xmldescription (class in kiwi.xml_description)": [[1, "kiwi.xml_description.XMLDescription", false]], "xmlstate (class in kiwi.xml_state)": [[1, "kiwi.xml_state.XMLState", false]], "xz() (kiwi.utils.compress.compress method)": [[25, "kiwi.utils.compress.Compress.xz", false]]}, "objects": {"": [[1, 0, 0, "-", "kiwi"]], "kiwi": [[1, 0, 0, "-", "app"], [2, 0, 0, "-", "archive"], [3, 0, 0, "-", "boot"], [5, 0, 0, "-", "bootloader"], [9, 0, 0, "-", "builder"], [1, 0, 0, "-", "cli"], [1, 0, 0, "-", "command"], [1, 0, 0, "-", "command_process"], [10, 0, 0, "-", "container"], [1, 0, 0, "-", "defaults"], [1, 0, 0, "-", "exceptions"], [12, 0, 0, "-", "filesystem"], [1, 0, 0, "-", "firmware"], [1, 0, 0, "-", "help"], [13, 0, 0, "-", "iso_tools"], [1, 0, 0, "-", "kiwi"], [1, 0, 0, "-", "logger"], [1, 0, 0, "-", "logger_color_formatter"], [1, 0, 0, "-", "logger_filter"], [1, 0, 0, "-", "mount_manager"], [14, 0, 0, "-", "package_manager"], [15, 0, 0, "-", "partitioner"], [1, 0, 0, "-", "path"], [1, 0, 0, "-", "privileges"], [16, 0, 0, "-", "repository"], [1, 0, 0, "-", "runtime_checker"], [1, 0, 0, "-", "runtime_config"], [18, 0, 0, "-", "solver"], [20, 0, 0, "-", "storage"], [23, 0, 0, "-", "system"], [24, 0, 0, "-", "tasks"], [25, 0, 0, "-", "utils"], [1, 0, 0, "-", "version"], [26, 0, 0, "-", "volume_manager"], [1, 0, 0, "-", "xml_description"], [1, 0, 0, "-", "xml_state"]], "kiwi.app": [[1, 1, 1, "", "App"]], "kiwi.archive": [[2, 0, 0, "-", "cpio"], [2, 0, 0, "-", "tar"]], "kiwi.archive.cpio": [[2, 1, 1, "", "ArchiveCpio"]], "kiwi.archive.cpio.ArchiveCpio": [[2, 2, 1, "", "create"], [2, 2, 1, "", "extract"]], "kiwi.archive.tar": [[2, 1, 1, "", "ArchiveTar"]], "kiwi.archive.tar.ArchiveTar": [[2, 2, 1, "", "append_files"], [2, 2, 1, "", "create"], [2, 2, 1, "", "create_gnu_gzip_compressed"], [2, 2, 1, "", "create_xz_compressed"], [2, 2, 1, "", "extract"]], "kiwi.boot": [[4, 0, 0, "-", "image"]], "kiwi.boot.image": [[4, 1, 1, "", "BootImage"], [4, 0, 0, "-", "base"], [4, 0, 0, "-", "builtin_kiwi"], [4, 0, 0, "-", "dracut"]], "kiwi.boot.image.BootImage": [[4, 2, 1, "", "new"]], "kiwi.boot.image.base": [[4, 1, 1, "", "BootImageBase"], [4, 1, 1, "", "boot_names_type"]], "kiwi.boot.image.base.BootImageBase": [[4, 2, 1, "", "cleanup"], [4, 2, 1, "", "create_initrd"], [4, 2, 1, "", "get_boot_description_directory"], [4, 2, 1, "", "get_boot_names"], [4, 2, 1, "", "has_initrd_support"], [4, 2, 1, "", "import_system_description_elements"], [4, 2, 1, "", "include_file"], [4, 2, 1, "", "include_module"], [4, 2, 1, "", "is_prepared"], [4, 2, 1, "", "load_boot_xml_description"], [4, 2, 1, "", "omit_module"], [4, 2, 1, "", "post_init"], [4, 2, 1, "", "prepare"], [4, 2, 1, "", "set_static_modules"], [4, 2, 1, "", "write_system_config_file"]], "kiwi.boot.image.base.boot_names_type": [[4, 3, 1, "", "initrd_name"], [4, 3, 1, "", "kernel_filename"], [4, 3, 1, "", "kernel_name"], [4, 3, 1, "", "kernel_version"]], "kiwi.boot.image.builtin_kiwi": [[4, 1, 1, "", "BootImageKiwi"]], "kiwi.boot.image.builtin_kiwi.BootImageKiwi": [[4, 2, 1, "", "cleanup"], [4, 2, 1, "", "create_initrd"], [4, 2, 1, "", "has_initrd_support"], [4, 2, 1, "", "post_init"], [4, 2, 1, "", "prepare"]], "kiwi.boot.image.dracut": [[4, 1, 1, "", "BootImageDracut"]], "kiwi.boot.image.dracut.BootImageDracut": [[4, 2, 1, "", "create_initrd"], [4, 2, 1, "", "has_initrd_support"], [4, 2, 1, "", "include_file"], [4, 2, 1, "", "include_module"], [4, 2, 1, "", "omit_module"], [4, 2, 1, "", "post_init"], [4, 2, 1, "", "prepare"], [4, 2, 1, "", "set_static_modules"], [4, 2, 1, "", "write_system_config_file"]], "kiwi.bootloader": [[6, 0, 0, "-", "config"], [7, 0, 0, "-", "install"], [8, 0, 0, "-", "template"]], "kiwi.bootloader.config": [[6, 0, 0, "-", "base"], [6, 4, 1, "", "create_boot_loader_config"], [6, 0, 0, "-", "grub2"], [6, 0, 0, "-", "systemd_boot"], [6, 0, 0, "-", "zipl"]], "kiwi.bootloader.config.base": [[6, 1, 1, "", "BootLoaderConfigBase"]], "kiwi.bootloader.config.base.BootLoaderConfigBase": [[6, 2, 1, "", "create_efi_path"], [6, 2, 1, "", "failsafe_boot_entry_requested"], [6, 2, 1, "", "get_boot_cmdline"], [6, 2, 1, "", "get_boot_path"], [6, 2, 1, "", "get_boot_theme"], [6, 2, 1, "", "get_boot_timeout_seconds"], [6, 2, 1, "", "get_continue_on_timeout"], [6, 2, 1, "", "get_gfxmode"], [6, 2, 1, "", "get_install_image_boot_default"], [6, 2, 1, "", "get_menu_entry_install_title"], [6, 2, 1, "", "get_menu_entry_title"], [6, 2, 1, "", "post_init"], [6, 2, 1, "", "quote_title"], [6, 2, 1, "", "setup_disk_boot_images"], [6, 2, 1, "", "setup_disk_image_config"], [6, 2, 1, "", "setup_install_boot_images"], [6, 2, 1, "", "setup_install_image_config"], [6, 2, 1, "", "setup_live_boot_images"], [6, 2, 1, "", "setup_live_image_config"], [6, 2, 1, "", "setup_sysconfig_bootloader"], [6, 2, 1, "", "write"], [6, 2, 1, "", "write_meta_data"]], "kiwi.bootloader.config.grub2": [[6, 1, 1, "", "BootLoaderConfigGrub2"]], "kiwi.bootloader.config.grub2.BootLoaderConfigGrub2": [[6, 2, 1, "", "post_init"], [6, 2, 1, "", "setup_disk_boot_images"], [6, 2, 1, "", "setup_disk_image_config"], [6, 2, 1, "", "setup_install_boot_images"], [6, 2, 1, "", "setup_install_image_config"], [6, 2, 1, "", "setup_live_boot_images"], [6, 2, 1, "", "setup_live_image_config"], [6, 2, 1, "", "setup_sysconfig_bootloader"], [6, 2, 1, "", "write"], [6, 2, 1, "", "write_meta_data"]], "kiwi.bootloader.config.systemd_boot": [[6, 1, 1, "", "BootLoaderSystemdBoot"]], "kiwi.bootloader.config.systemd_boot.BootLoaderSystemdBoot": [[6, 2, 1, "", "create_loader_image"], [6, 2, 1, "", "set_loader_entry"], [6, 2, 1, "", "setup_loader"]], "kiwi.bootloader.config.zipl": [[6, 1, 1, "", "BootLoaderZipl"]], "kiwi.bootloader.config.zipl.BootLoaderZipl": [[6, 2, 1, "", "create_loader_image"], [6, 2, 1, "", "set_loader_entry"], [6, 2, 1, "", "setup_loader"]], "kiwi.bootloader.install": [[7, 1, 1, "", "BootLoaderInstall"], [7, 0, 0, "-", "base"], [7, 0, 0, "-", "grub2"], [7, 0, 0, "-", "systemd_boot"], [7, 0, 0, "-", "zipl"]], "kiwi.bootloader.install.BootLoaderInstall": [[7, 2, 1, "", "new"]], "kiwi.bootloader.install.base": [[7, 1, 1, "", "BootLoaderInstallBase"]], "kiwi.bootloader.install.base.BootLoaderInstallBase": [[7, 2, 1, "", "install"], [7, 2, 1, "", "install_required"], [7, 2, 1, "", "post_init"], [7, 2, 1, "", "secure_boot_install"]], "kiwi.bootloader.install.grub2": [[7, 1, 1, "", "BootLoaderInstallGrub2"]], "kiwi.bootloader.install.grub2.BootLoaderInstallGrub2": [[7, 2, 1, "", "install"], [7, 2, 1, "", "install_required"], [7, 2, 1, "", "post_init"], [7, 2, 1, "", "secure_boot_install"], [7, 2, 1, "", "set_disk_password"]], "kiwi.bootloader.install.systemd_boot": [[7, 1, 1, "", "BootLoaderInstallSystemdBoot"]], "kiwi.bootloader.install.systemd_boot.BootLoaderInstallSystemdBoot": [[7, 2, 1, "", "install_required"], [7, 2, 1, "", "post_init"], [7, 2, 1, "", "secure_boot_install"]], "kiwi.bootloader.install.zipl": [[7, 1, 1, "", "BootLoaderInstallZipl"]], "kiwi.bootloader.install.zipl.BootLoaderInstallZipl": [[7, 2, 1, "", "install_required"], [7, 2, 1, "", "post_init"], [7, 2, 1, "", "secure_boot_install"]], "kiwi.bootloader.template": [[8, 0, 0, "-", "grub2"]], "kiwi.bootloader.template.grub2": [[8, 1, 1, "", "BootLoaderTemplateGrub2"]], "kiwi.bootloader.template.grub2.BootLoaderTemplateGrub2": [[8, 2, 1, "", "get_install_template"], [8, 2, 1, "", "get_iso_template"], [8, 2, 1, "", "get_multiboot_install_template"], [8, 2, 1, "", "get_multiboot_iso_template"]], "kiwi.builder": [[9, 1, 1, "", "ImageBuilder"], [9, 0, 0, "-", "archive"], [9, 0, 0, "-", "container"], [9, 0, 0, "-", "disk"], [9, 0, 0, "-", "filesystem"], [9, 0, 0, "-", "install"], [9, 0, 0, "-", "kis"], [9, 0, 0, "-", "live"]], "kiwi.builder.ImageBuilder": [[9, 2, 1, "", "new"]], "kiwi.builder.archive": [[9, 1, 1, "", "ArchiveBuilder"]], "kiwi.builder.archive.ArchiveBuilder": [[9, 2, 1, "", "create"]], "kiwi.builder.container": [[9, 1, 1, "", "ContainerBuilder"]], "kiwi.builder.container.ContainerBuilder": [[9, 2, 1, "", "create"]], "kiwi.builder.disk": [[9, 1, 1, "", "DiskBuilder"], [9, 1, 1, "", "StorageMap"]], "kiwi.builder.disk.DiskBuilder": [[9, 2, 1, "", "append_unpartitioned_space"], [9, 2, 1, "", "create"], [9, 2, 1, "", "create_disk"], [9, 2, 1, "", "create_disk_format"], [9, 2, 1, "", "create_install_media"]], "kiwi.builder.disk.StorageMap": [[9, 3, 1, "", "integrity_root"], [9, 3, 1, "", "luks_root"], [9, 3, 1, "", "raid_root"], [9, 3, 1, "", "system"], [9, 3, 1, "", "system_boot"], [9, 3, 1, "", "system_custom_parts"], [9, 3, 1, "", "system_efi"], [9, 3, 1, "", "system_spare"]], "kiwi.builder.filesystem": [[9, 1, 1, "", "FileSystemBuilder"]], "kiwi.builder.filesystem.FileSystemBuilder": [[9, 2, 1, "", "create"]], "kiwi.builder.install": [[9, 1, 1, "", "InstallImageBuilder"]], "kiwi.builder.install.InstallImageBuilder": [[9, 2, 1, "", "create_install_iso"], [9, 2, 1, "", "create_install_pxe_archive"]], "kiwi.builder.kis": [[9, 1, 1, "", "KisBuilder"]], "kiwi.builder.kis.KisBuilder": [[9, 2, 1, "", "create"]], "kiwi.builder.live": [[9, 1, 1, "", "LiveImageBuilder"]], "kiwi.builder.live.LiveImageBuilder": [[9, 2, 1, "", "create"]], "kiwi.cli": [[1, 1, 1, "", "Cli"]], "kiwi.cli.Cli": [[1, 2, 1, "", "get_command"], [1, 2, 1, "", "get_command_args"], [1, 2, 1, "", "get_global_args"], [1, 2, 1, "", "get_servicename"], [1, 2, 1, "", "load_command"], [1, 2, 1, "", "show_and_exit_on_help_request"]], "kiwi.command": [[1, 1, 1, "", "Command"], [1, 1, 1, "", "CommandCallT"], [1, 1, 1, "", "CommandT"]], "kiwi.command.Command": [[1, 2, 1, "", "call"], [1, 2, 1, "", "run"]], "kiwi.command.CommandCallT": [[1, 3, 1, "", "error"], [1, 3, 1, "", "error_available"], [1, 3, 1, "", "output"], [1, 3, 1, "", "output_available"], [1, 3, 1, "", "process"]], "kiwi.command.CommandT": [[1, 3, 1, "", "error"], [1, 3, 1, "", "output"], [1, 3, 1, "", "returncode"]], "kiwi.command_process": [[1, 1, 1, "", "CommandIterator"], [1, 1, 1, "", "CommandProcess"]], "kiwi.command_process.CommandIterator": [[1, 2, 1, "", "get_error_code"], [1, 2, 1, "", "get_error_output"], [1, 2, 1, "", "get_pid"], [1, 2, 1, "", "kill"]], "kiwi.command_process.CommandProcess": [[1, 2, 1, "", "create_match_method"], [1, 2, 1, "", "poll"], [1, 2, 1, "", "poll_and_watch"], [1, 2, 1, "", "poll_show_progress"], [1, 2, 1, "", "returncode"]], "kiwi.container": [[10, 1, 1, "", "ContainerImage"], [10, 0, 0, "-", "oci"], [11, 0, 0, "-", "setup"]], "kiwi.container.ContainerImage": [[10, 2, 1, "", "new"]], "kiwi.container.oci": [[10, 1, 1, "", "ContainerImageOCI"], [10, 1, 1, "", "OciConfig"]], "kiwi.container.oci.ContainerImageOCI": [[10, 2, 1, "", "create"]], "kiwi.container.oci.OciConfig": [[10, 3, 1, "", "additional_names"], [10, 3, 1, "", "container_name"], [10, 3, 1, "", "container_tag"], [10, 3, 1, "", "entry_command"], [10, 3, 1, "", "entry_subcommand"], [10, 3, 1, "", "environment"], [10, 3, 1, "", "expose_ports"], [10, 3, 1, "", "history"], [10, 3, 1, "", "labels"], [10, 3, 1, "", "maintainer"], [10, 3, 1, "", "user"], [10, 3, 1, "", "volumes"], [10, 3, 1, "", "workingdir"]], "kiwi.container.setup": [[11, 1, 1, "", "ContainerSetup"], [11, 0, 0, "-", "base"], [11, 0, 0, "-", "docker"]], "kiwi.container.setup.ContainerSetup": [[11, 2, 1, "", "new"]], "kiwi.container.setup.base": [[11, 1, 1, "", "ContainerSetupBase"]], "kiwi.container.setup.base.ContainerSetupBase": [[11, 2, 1, "", "deactivate_bootloader_setup"], [11, 2, 1, "", "deactivate_root_filesystem_check"], [11, 2, 1, "", "deactivate_systemd_service"], [11, 2, 1, "", "get_container_name"], [11, 2, 1, "", "post_init"], [11, 2, 1, "", "setup"], [11, 2, 1, "", "setup_root_console"]], "kiwi.container.setup.docker": [[11, 1, 1, "", "ContainerSetupDocker"]], "kiwi.defaults": [[1, 1, 1, "", "Defaults"], [1, 1, 1, "", "grub_loader_type"], [1, 1, 1, "", "shim_loader_type"], [1, 1, 1, "", "unit_type"]], "kiwi.defaults.Defaults": [[1, 2, 1, "", "get"], [1, 2, 1, "", "get_archive_image_types"], [1, 2, 1, "", "get_bios_image_name"], [1, 2, 1, "", "get_bios_module_directory_name"], [1, 2, 1, "", "get_bls_loader_entries_dir"], [1, 2, 1, "", "get_boot_image_description_path"], [1, 2, 1, "", "get_boot_image_strip_file"], [1, 2, 1, "", "get_buildservice_env_name"], [1, 2, 1, "", "get_common_functions_file"], [1, 2, 1, "", "get_container_base_image_tag"], [1, 2, 1, "", "get_container_compression"], [1, 2, 1, "", "get_container_image_types"], [1, 2, 1, "", "get_custom_rpm_bootstrap_macro_name"], [1, 2, 1, "", "get_custom_rpm_image_macro_name"], [1, 2, 1, "", "get_custom_rpm_macros_path"], [1, 2, 1, "", "get_default_boot_mbytes"], [1, 2, 1, "", "get_default_boot_timeout_seconds"], [1, 2, 1, "", "get_default_bootloader"], [1, 2, 1, "", "get_default_container_created_by"], [1, 2, 1, "", "get_default_container_name"], [1, 2, 1, "", "get_default_container_subcommand"], [1, 2, 1, "", "get_default_container_tag"], [1, 2, 1, "", "get_default_disk_start_sector"], [1, 2, 1, "", "get_default_efi_boot_mbytes"], [1, 2, 1, "", "get_default_efi_partition_table_type"], [1, 2, 1, "", "get_default_firmware"], [1, 2, 1, "", "get_default_inode_size"], [1, 2, 1, "", "get_default_legacy_bios_mbytes"], [1, 2, 1, "", "get_default_live_iso_root_filesystem"], [1, 2, 1, "", "get_default_live_iso_type"], [1, 2, 1, "", "get_default_package_manager"], [1, 2, 1, "", "get_default_packager_tool"], [1, 2, 1, "", "get_default_prep_mbytes"], [1, 2, 1, "", "get_default_uri_type"], [1, 2, 1, "", "get_default_video_mode"], [1, 2, 1, "", "get_default_volume_group_name"], [1, 2, 1, "", "get_discoverable_partition_ids"], [1, 2, 1, "", "get_disk_format_types"], [1, 2, 1, "", "get_disk_image_types"], [1, 2, 1, "", "get_dracut_conf_name"], [1, 2, 1, "", "get_ec2_capable_firmware_names"], [1, 2, 1, "", "get_efi_capable_firmware_names"], [1, 2, 1, "", "get_efi_image_name"], [1, 2, 1, "", "get_efi_module_directory_name"], [1, 2, 1, "", "get_efi_vendor_directory"], [1, 2, 1, "", "get_enclaves_image_types"], [1, 2, 1, "", "get_exclude_list_for_non_physical_devices"], [1, 2, 1, "", "get_exclude_list_for_removed_files_detection"], [1, 2, 1, "", "get_exclude_list_for_root_data_sync"], [1, 2, 1, "", "get_exclude_list_from_custom_exclude_files"], [1, 2, 1, "", "get_failsafe_kernel_options"], [1, 2, 1, "", "get_filesystem_image_types"], [1, 2, 1, "", "get_firmware_types"], [1, 2, 1, "", "get_grub_basic_modules"], [1, 2, 1, "", "get_grub_bios_core_loader"], [1, 2, 1, "", "get_grub_bios_modules"], [1, 2, 1, "", "get_grub_boot_directory_name"], [1, 2, 1, "", "get_grub_custom_arguments"], [1, 2, 1, "", "get_grub_efi_font_directory"], [1, 2, 1, "", "get_grub_efi_modules"], [1, 2, 1, "", "get_grub_ofw_modules"], [1, 2, 1, "", "get_grub_path"], [1, 2, 1, "", "get_grub_s390_modules"], [1, 2, 1, "", "get_imported_root_image"], [1, 2, 1, "", "get_install_volume_id"], [1, 2, 1, "", "get_iso_boot_path"], [1, 2, 1, "", "get_iso_grub_loader"], [1, 2, 1, "", "get_iso_grub_mbr"], [1, 2, 1, "", "get_iso_media_tag_tool"], [1, 2, 1, "", "get_iso_tool_category"], [1, 2, 1, "", "get_kis_image_types"], [1, 2, 1, "", "get_live_dracut_modules_from_flag"], [1, 2, 1, "", "get_live_image_types"], [1, 2, 1, "", "get_live_iso_persistent_boot_options"], [1, 2, 1, "", "get_luks_key_length"], [1, 2, 1, "", "get_lvm_overhead_mbytes"], [1, 2, 1, "", "get_min_partition_mbytes"], [1, 2, 1, "", "get_min_volume_mbytes"], [1, 2, 1, "", "get_mok_manager"], [1, 2, 1, "", "get_obs_api_server_url"], [1, 2, 1, "", "get_obs_download_server_url"], [1, 2, 1, "", "get_oci_archive_tool"], [1, 2, 1, "", "get_part_mapper_tool"], [1, 2, 1, "", "get_platform_name"], [1, 2, 1, "", "get_preparer"], [1, 2, 1, "", "get_profile_file"], [1, 2, 1, "", "get_publisher"], [1, 2, 1, "", "get_recovery_spare_mbytes"], [1, 2, 1, "", "get_removed_files_name"], [1, 2, 1, "", "get_runtime_checker_metadata"], [1, 2, 1, "", "get_schema_file"], [1, 2, 1, "", "get_schematron_module_name"], [1, 2, 1, "", "get_shared_cache_location"], [1, 2, 1, "", "get_shim_loader"], [1, 2, 1, "", "get_shim_vendor_directory"], [1, 2, 1, "", "get_signed_grub_loader"], [1, 2, 1, "", "get_snapper_config_template_file"], [1, 2, 1, "", "get_solvable_location"], [1, 2, 1, "", "get_swapsize_mbytes"], [1, 2, 1, "", "get_sync_options"], [1, 2, 1, "", "get_temp_location"], [1, 2, 1, "", "get_unsigned_grub_loader"], [1, 2, 1, "", "get_vagrant_config_virtualbox_guest_additions"], [1, 2, 1, "", "get_vendor_grubenv"], [1, 2, 1, "", "get_video_mode_map"], [1, 2, 1, "", "get_volume_id"], [1, 2, 1, "", "get_xsl_stylesheet_file"], [1, 2, 1, "", "get_xz_compression_options"], [1, 2, 1, "", "is_buildservice_worker"], [1, 2, 1, "", "is_ppc64_arch"], [1, 2, 1, "", "is_x86_arch"], [1, 2, 1, "", "project_file"], [1, 2, 1, "", "set_custom_runtime_config_file"], [1, 2, 1, "", "set_platform_name"], [1, 2, 1, "", "set_runtime_checker_metadata"], [1, 2, 1, "", "set_shared_cache_location"], [1, 2, 1, "", "set_temp_location"], [1, 2, 1, "", "to_profile"]], "kiwi.defaults.grub_loader_type": [[1, 3, 1, "", "binaryname"], [1, 3, 1, "", "filename"]], "kiwi.defaults.shim_loader_type": [[1, 3, 1, "", "binaryname"], [1, 3, 1, "", "filename"]], "kiwi.defaults.unit_type": [[1, 3, 1, "", "byte"], [1, 3, 1, "", "gb"], [1, 3, 1, "", "kb"], [1, 3, 1, "", "mb"]], "kiwi.exceptions": [[1, 5, 1, "", "KiwiAnyMarkupPluginError"], [1, 5, 1, "", "KiwiArchiveSetupError"], [1, 5, 1, "", "KiwiArchiveTarError"], [1, 5, 1, "", "KiwiBootImageSetupError"], [1, 5, 1, "", "KiwiBootLoaderConfigSetupError"], [1, 5, 1, "", "KiwiBootLoaderDiskPasswordError"], [1, 5, 1, "", "KiwiBootLoaderGrubDataError"], [1, 5, 1, "", "KiwiBootLoaderGrubFontError"], [1, 5, 1, "", "KiwiBootLoaderGrubInstallError"], [1, 5, 1, "", "KiwiBootLoaderGrubModulesError"], [1, 5, 1, "", "KiwiBootLoaderGrubPlatformError"], [1, 5, 1, "", "KiwiBootLoaderGrubSecureBootError"], [1, 5, 1, "", "KiwiBootLoaderInstallSetupError"], [1, 5, 1, "", "KiwiBootLoaderTargetError"], [1, 5, 1, "", "KiwiBootLoaderZiplInstallError"], [1, 5, 1, "", "KiwiBootLoaderZiplPlatformError"], [1, 5, 1, "", "KiwiBootLoaderZiplSetupError"], [1, 5, 1, "", "KiwiBootStrapPhaseFailed"], [1, 5, 1, "", "KiwiBuildahError"], [1, 5, 1, "", "KiwiBundleError"], [1, 5, 1, "", "KiwiCommandCapabilitiesError"], [1, 5, 1, "", "KiwiCommandError"], [1, 5, 1, "", "KiwiCommandNotFound"], [1, 5, 1, "", "KiwiCommandNotLoaded"], [1, 5, 1, "", "KiwiCompressionFormatUnknown"], [1, 5, 1, "", "KiwiConfigFileFormatNotSupported"], [1, 5, 1, "", "KiwiConfigFileNotFound"], [1, 5, 1, "", "KiwiContainerBuilderError"], [1, 5, 1, "", "KiwiContainerImageSetupError"], [1, 5, 1, "", "KiwiContainerSetupError"], [1, 5, 1, "", "KiwiCredentialsError"], [1, 5, 1, "", "KiwiCustomPartitionConflictError"], [1, 5, 1, "", "KiwiDataStructureError"], [1, 5, 1, "", "KiwiDebianBootstrapError"], [1, 5, 1, "", "KiwiDecodingError"], [1, 5, 1, "", "KiwiDescriptionInvalid"], [1, 5, 1, "", "KiwiDeviceProviderError"], [1, 5, 1, "", "KiwiDiskBootImageError"], [1, 5, 1, "", "KiwiDiskFormatSetupError"], [1, 5, 1, "", "KiwiDiskGeometryError"], [1, 5, 1, "", "KiwiDistributionNameError"], [1, 5, 1, "", "KiwiEnclaveBootImageError"], [1, 5, 1, "", "KiwiEnclaveFormatError"], [1, 5, 1, "", "KiwiError"], [1, 5, 1, "", "KiwiExtensionError"], [1, 5, 1, "", "KiwiFileAccessError"], [1, 5, 1, "", "KiwiFileNotFound"], [1, 5, 1, "", "KiwiFileSystemSetupError"], [1, 5, 1, "", "KiwiFileSystemSyncError"], [1, 5, 1, "", "KiwiFormatSetupError"], [1, 5, 1, "", "KiwiHelpNoCommandGiven"], [1, 5, 1, "", "KiwiImageResizeError"], [1, 5, 1, "", "KiwiImportDescriptionError"], [1, 5, 1, "", "KiwiIncludFileNotFoundError"], [1, 5, 1, "", "KiwiInstallBootImageError"], [1, 5, 1, "", "KiwiInstallMediaError"], [1, 5, 1, "", "KiwiInstallPhaseFailed"], [1, 5, 1, "", "KiwiIsoMetaDataError"], [1, 5, 1, "", "KiwiIsoToolError"], [1, 5, 1, "", "KiwiKernelLookupError"], [1, 5, 1, "", "KiwiKisBootImageError"], [1, 5, 1, "", "KiwiLiveBootImageError"], [1, 5, 1, "", "KiwiLoadCommandUndefined"], [1, 5, 1, "", "KiwiLogFileSetupFailed"], [1, 5, 1, "", "KiwiLogSocketSetupFailed"], [1, 5, 1, "", "KiwiLoopSetupError"], [1, 5, 1, "", "KiwiLuksSetupError"], [1, 5, 1, "", "KiwiMappedDeviceError"], [1, 5, 1, "", "KiwiMarkupConversionError"], [1, 5, 1, "", "KiwiMountKernelFileSystemsError"], [1, 5, 1, "", "KiwiMountSharedDirectoryError"], [1, 5, 1, "", "KiwiNotImplementedError"], [1, 5, 1, "", "KiwiOCIArchiveToolError"], [1, 5, 1, "", "KiwiOSReleaseImportError"], [1, 5, 1, "", "KiwiOffsetError"], [1, 5, 1, "", "KiwiPackageManagerSetupError"], [1, 5, 1, "", "KiwiPackagesDeletePhaseFailed"], [1, 5, 1, "", "KiwiPartitionTooSmallError"], [1, 5, 1, "", "KiwiPartitionerGptFlagError"], [1, 5, 1, "", "KiwiPartitionerMsDosFlagError"], [1, 5, 1, "", "KiwiPartitionerSetupError"], [1, 5, 1, "", "KiwiPrivilegesError"], [1, 5, 1, "", "KiwiProfileNotFound"], [1, 5, 1, "", "KiwiRaidSetupError"], [1, 5, 1, "", "KiwiRepositorySetupError"], [1, 5, 1, "", "KiwiRequestError"], [1, 5, 1, "", "KiwiRequestedTypeError"], [1, 5, 1, "", "KiwiResizeRawDiskError"], [1, 5, 1, "", "KiwiResultError"], [1, 5, 1, "", "KiwiRootDirExists"], [1, 5, 1, "", "KiwiRootImportError"], [1, 5, 1, "", "KiwiRootInitCreationError"], [1, 5, 1, "", "KiwiRpmDirNotRemoteError"], [1, 5, 1, "", "KiwiRuntimeConfigFileError"], [1, 5, 1, "", "KiwiRuntimeConfigFormatError"], [1, 5, 1, "", "KiwiRuntimeError"], [1, 5, 1, "", "KiwiSatSolverJobError"], [1, 5, 1, "", "KiwiSatSolverJobProblems"], [1, 5, 1, "", "KiwiSatSolverPluginError"], [1, 5, 1, "", "KiwiSchemaImportError"], [1, 5, 1, "", "KiwiScriptFailed"], [1, 5, 1, "", "KiwiSetupIntermediateConfigError"], [1, 5, 1, "", "KiwiShellVariableValueError"], [1, 5, 1, "", "KiwiSizeError"], [1, 5, 1, "", "KiwiSolverRepositorySetupError"], [1, 5, 1, "", "KiwiSystemDeletePackagesFailed"], [1, 5, 1, "", "KiwiSystemInstallPackagesFailed"], [1, 5, 1, "", "KiwiSystemUpdateFailed"], [1, 5, 1, "", "KiwiTargetDirectoryNotFound"], [1, 5, 1, "", "KiwiTemplateError"], [1, 5, 1, "", "KiwiTypeNotFound"], [1, 5, 1, "", "KiwiUmountBusyError"], [1, 5, 1, "", "KiwiUnknownServiceName"], [1, 5, 1, "", "KiwiUriOpenError"], [1, 5, 1, "", "KiwiUriStyleUnknown"], [1, 5, 1, "", "KiwiUriTypeUnknown"], [1, 5, 1, "", "KiwiValidationError"], [1, 5, 1, "", "KiwiVhdTagError"], [1, 5, 1, "", "KiwiVolumeGroupConflict"], [1, 5, 1, "", "KiwiVolumeManagerSetupError"], [1, 5, 1, "", "KiwiVolumeRootIDError"], [1, 5, 1, "", "KiwiVolumeTooSmallError"]], "kiwi.filesystem": [[12, 1, 1, "", "FileSystem"], [12, 0, 0, "-", "base"], [12, 0, 0, "-", "btrfs"], [12, 0, 0, "-", "ext2"], [12, 0, 0, "-", "ext3"], [12, 0, 0, "-", "ext4"], [12, 0, 0, "-", "fat16"], [12, 0, 0, "-", "fat32"], [12, 0, 0, "-", "isofs"], [12, 0, 0, "-", "setup"], [12, 0, 0, "-", "squashfs"], [12, 0, 0, "-", "xfs"]], "kiwi.filesystem.FileSystem": [[12, 2, 1, "", "new"]], "kiwi.filesystem.base": [[12, 1, 1, "", "FileSystemBase"]], "kiwi.filesystem.base.FileSystemBase": [[12, 2, 1, "", "create_on_device"], [12, 2, 1, "", "create_on_file"], [12, 2, 1, "", "create_verification_metadata"], [12, 2, 1, "", "create_verity_layer"], [12, 2, 1, "", "get_fstab"], [12, 2, 1, "", "get_mountpoint"], [12, 2, 1, "", "get_root_volume_name"], [12, 2, 1, "", "get_volumes"], [12, 2, 1, "", "mount"], [12, 2, 1, "", "mount_volumes"], [12, 2, 1, "", "post_init"], [12, 2, 1, "", "set_property_readonly_root"], [12, 2, 1, "", "set_uuid"], [12, 2, 1, "", "sync_data"], [12, 2, 1, "", "umount"], [12, 2, 1, "", "umount_volumes"]], "kiwi.filesystem.btrfs": [[12, 1, 1, "", "FileSystemBtrfs"]], "kiwi.filesystem.btrfs.FileSystemBtrfs": [[12, 2, 1, "", "create_on_device"], [12, 2, 1, "", "set_uuid"]], "kiwi.filesystem.ext2": [[12, 1, 1, "", "FileSystemExt2"]], "kiwi.filesystem.ext2.FileSystemExt2": [[12, 2, 1, "", "create_on_device"], [12, 2, 1, "", "set_uuid"]], "kiwi.filesystem.ext3": [[12, 1, 1, "", "FileSystemExt3"]], "kiwi.filesystem.ext3.FileSystemExt3": [[12, 2, 1, "", "create_on_device"], [12, 2, 1, "", "set_uuid"]], "kiwi.filesystem.ext4": [[12, 1, 1, "", "FileSystemExt4"]], "kiwi.filesystem.ext4.FileSystemExt4": [[12, 2, 1, "", "create_on_device"], [12, 2, 1, "", "set_uuid"]], "kiwi.filesystem.fat16": [[12, 1, 1, "", "FileSystemFat16"]], "kiwi.filesystem.fat16.FileSystemFat16": [[12, 2, 1, "", "create_on_device"], [12, 2, 1, "", "set_uuid"]], "kiwi.filesystem.fat32": [[12, 1, 1, "", "FileSystemFat32"]], "kiwi.filesystem.fat32.FileSystemFat32": [[12, 2, 1, "", "create_on_device"], [12, 2, 1, "", "set_uuid"]], "kiwi.filesystem.isofs": [[12, 1, 1, "", "FileSystemIsoFs"]], "kiwi.filesystem.isofs.FileSystemIsoFs": [[12, 2, 1, "", "create_on_file"]], "kiwi.filesystem.setup": [[12, 1, 1, "", "FileSystemSetup"]], "kiwi.filesystem.setup.FileSystemSetup": [[12, 2, 1, "", "get_size_mbytes"]], "kiwi.filesystem.squashfs": [[12, 1, 1, "", "FileSystemSquashFs"]], "kiwi.filesystem.squashfs.FileSystemSquashFs": [[12, 2, 1, "", "create_on_file"]], "kiwi.filesystem.xfs": [[12, 1, 1, "", "FileSystemXfs"]], "kiwi.filesystem.xfs.FileSystemXfs": [[12, 2, 1, "", "create_on_device"], [12, 2, 1, "", "set_uuid"]], "kiwi.firmware": [[1, 1, 1, "", "FirmWare"]], "kiwi.firmware.FirmWare": [[1, 2, 1, "", "bios_mode"], [1, 2, 1, "", "ec2_mode"], [1, 2, 1, "", "efi_mode"], [1, 2, 1, "", "get_efi_partition_size"], [1, 2, 1, "", "get_legacy_bios_partition_size"], [1, 2, 1, "", "get_partition_table_type"], [1, 2, 1, "", "get_prep_partition_size"], [1, 2, 1, "", "legacy_bios_mode"], [1, 2, 1, "", "ofw_mode"], [1, 2, 1, "", "opal_mode"]], "kiwi.help": [[1, 1, 1, "", "Help"]], "kiwi.help.Help": [[1, 2, 1, "", "show"]], "kiwi.iso_tools": [[13, 1, 1, "", "IsoTools"], [13, 0, 0, "-", "base"], [13, 0, 0, "-", "iso"], [13, 0, 0, "-", "xorriso"]], "kiwi.iso_tools.IsoTools": [[13, 2, 1, "", "new"]], "kiwi.iso_tools.base": [[13, 1, 1, "", "IsoToolsBase"]], "kiwi.iso_tools.base.IsoToolsBase": [[13, 2, 1, "", "add_efi_loader_parameters"], [13, 2, 1, "", "create_iso"], [13, 2, 1, "", "get_tool_name"], [13, 2, 1, "", "has_iso_hybrid_capability"], [13, 2, 1, "", "init_iso_creation_parameters"], [13, 2, 1, "", "list_iso"], [13, 2, 1, "", "setup_media_loader_directory"]], "kiwi.iso_tools.iso": [[13, 1, 1, "", "Iso"]], "kiwi.iso_tools.iso.Iso": [[13, 2, 1, "", "set_media_tag"]], "kiwi.iso_tools.xorriso": [[13, 1, 1, "", "IsoToolsXorrIso"]], "kiwi.iso_tools.xorriso.IsoToolsXorrIso": [[13, 2, 1, "", "add_efi_loader_parameters"], [13, 2, 1, "", "create_iso"], [13, 2, 1, "", "get_tool_name"], [13, 2, 1, "", "has_iso_hybrid_capability"], [13, 2, 1, "", "init_iso_creation_parameters"]], "kiwi.kiwi": [[1, 4, 1, "", "extras"], [1, 4, 1, "", "main"], [1, 4, 1, "", "usage"]], "kiwi.logger": [[1, 1, 1, "", "Logger"]], "kiwi.logger.Logger": [[1, 2, 1, "", "getLogFlags"], [1, 2, 1, "", "getLogLevel"], [1, 2, 1, "", "get_logfile"], [1, 2, 1, "", "progress"], [1, 2, 1, "", "setLogFlag"], [1, 2, 1, "", "setLogLevel"], [1, 2, 1, "", "set_color_format"], [1, 2, 1, "", "set_log_socket"], [1, 2, 1, "", "set_logfile"]], "kiwi.logger_color_formatter": [[1, 1, 1, "", "ColorFormatter"], [1, 1, 1, "", "ColorMessage"]], "kiwi.logger_color_formatter.ColorFormatter": [[1, 2, 1, "", "format"]], "kiwi.logger_color_formatter.ColorMessage": [[1, 2, 1, "", "format_message"]], "kiwi.logger_filter": [[1, 1, 1, "", "DebugFilter"], [1, 1, 1, "", "ErrorFilter"], [1, 1, 1, "", "InfoFilter"], [1, 1, 1, "", "LoggerSchedulerFilter"], [1, 1, 1, "", "WarningFilter"]], "kiwi.logger_filter.DebugFilter": [[1, 2, 1, "", "filter"]], "kiwi.logger_filter.ErrorFilter": [[1, 2, 1, "", "filter"]], "kiwi.logger_filter.InfoFilter": [[1, 2, 1, "", "filter"]], "kiwi.logger_filter.LoggerSchedulerFilter": [[1, 2, 1, "", "filter"]], "kiwi.logger_filter.WarningFilter": [[1, 2, 1, "", "filter"]], "kiwi.mount_manager": [[1, 1, 1, "", "MountManager"]], "kiwi.mount_manager.MountManager": [[1, 2, 1, "", "bind_mount"], [1, 2, 1, "", "get_attributes"], [1, 2, 1, "", "is_mounted"], [1, 2, 1, "", "mount"], [1, 2, 1, "", "overlay_mount"], [1, 2, 1, "", "tmpfs_mount"], [1, 2, 1, "", "umount"], [1, 2, 1, "", "umount_lazy"]], "kiwi.package_manager": [[14, 1, 1, "", "PackageManager"], [14, 0, 0, "-", "base"], [14, 0, 0, "-", "dnf4"], [14, 0, 0, "-", "zypper"]], "kiwi.package_manager.PackageManager": [[14, 2, 1, "", "new"]], "kiwi.package_manager.base": [[14, 1, 1, "", "PackageManagerBase"]], "kiwi.package_manager.base.PackageManagerBase": [[14, 2, 1, "", "clean_leftovers"], [14, 2, 1, "", "cleanup_requests"], [14, 2, 1, "", "database_consistent"], [14, 2, 1, "", "dump_reload_package_database"], [14, 2, 1, "", "get_error_details"], [14, 2, 1, "", "has_failed"], [14, 2, 1, "", "match_package_deleted"], [14, 2, 1, "", "match_package_installed"], [14, 2, 1, "", "post_init"], [14, 2, 1, "", "post_process_delete_requests"], [14, 2, 1, "", "post_process_install_requests_bootstrap"], [14, 2, 1, "", "process_delete_requests"], [14, 2, 1, "", "process_install_requests"], [14, 2, 1, "", "process_install_requests_bootstrap"], [14, 2, 1, "", "process_only_required"], [14, 2, 1, "", "process_plus_recommended"], [14, 2, 1, "", "request_collection"], [14, 2, 1, "", "request_package"], [14, 2, 1, "", "request_package_exclusion"], [14, 2, 1, "", "request_package_lock"], [14, 2, 1, "", "request_product"], [14, 2, 1, "", "setup_repository_modules"], [14, 2, 1, "", "update"]], "kiwi.package_manager.dnf4": [[14, 1, 1, "", "PackageManagerDnf4"]], "kiwi.package_manager.dnf4.PackageManagerDnf4": [[14, 2, 1, "", "clean_leftovers"], [14, 2, 1, "", "match_package_deleted"], [14, 2, 1, "", "match_package_installed"], [14, 2, 1, "", "post_init"], [14, 2, 1, "", "post_process_install_requests_bootstrap"], [14, 2, 1, "", "process_delete_requests"], [14, 2, 1, "", "process_install_requests"], [14, 2, 1, "", "process_install_requests_bootstrap"], [14, 2, 1, "", "process_only_required"], [14, 2, 1, "", "process_plus_recommended"], [14, 2, 1, "", "request_collection"], [14, 2, 1, "", "request_package"], [14, 2, 1, "", "request_package_exclusion"], [14, 2, 1, "", "request_product"], [14, 2, 1, "", "setup_repository_modules"], [14, 2, 1, "", "update"]], "kiwi.package_manager.zypper": [[14, 1, 1, "", "PackageManagerZypper"]], "kiwi.package_manager.zypper.PackageManagerZypper": [[14, 2, 1, "", "clean_leftovers"], [14, 2, 1, "", "has_failed"], [14, 2, 1, "", "match_package_deleted"], [14, 2, 1, "", "match_package_installed"], [14, 2, 1, "", "post_init"], [14, 2, 1, "", "post_process_install_requests_bootstrap"], [14, 2, 1, "", "process_delete_requests"], [14, 2, 1, "", "process_install_requests"], [14, 2, 1, "", "process_install_requests_bootstrap"], [14, 2, 1, "", "process_only_required"], [14, 2, 1, "", "process_plus_recommended"], [14, 2, 1, "", "request_collection"], [14, 2, 1, "", "request_package"], [14, 2, 1, "", "request_package_exclusion"], [14, 2, 1, "", "request_product"], [14, 2, 1, "", "setup_repository_modules"], [14, 2, 1, "", "update"]], "kiwi.partitioner": [[15, 1, 1, "", "Partitioner"], [15, 0, 0, "-", "base"], [15, 0, 0, "-", "dasd"], [15, 0, 0, "-", "gpt"], [15, 0, 0, "-", "msdos"]], "kiwi.partitioner.Partitioner": [[15, 2, 1, "", "new"]], "kiwi.partitioner.base": [[15, 1, 1, "", "PartitionerBase"]], "kiwi.partitioner.base.PartitionerBase": [[15, 2, 1, "", "create"], [15, 2, 1, "", "get_id"], [15, 2, 1, "", "post_init"], [15, 2, 1, "", "resize_table"], [15, 2, 1, "", "set_flag"], [15, 2, 1, "", "set_hybrid_mbr"], [15, 2, 1, "", "set_mbr"], [15, 2, 1, "", "set_start_sector"], [15, 2, 1, "", "set_uuid"]], "kiwi.partitioner.dasd": [[15, 1, 1, "", "PartitionerDasd"]], "kiwi.partitioner.dasd.PartitionerDasd": [[15, 2, 1, "", "create"], [15, 2, 1, "", "post_init"], [15, 2, 1, "", "resize_table"], [15, 2, 1, "", "set_uuid"]], "kiwi.partitioner.gpt": [[15, 1, 1, "", "PartitionerGpt"]], "kiwi.partitioner.gpt.PartitionerGpt": [[15, 2, 1, "", "create"], [15, 2, 1, "", "post_init"], [15, 2, 1, "", "resize_table"], [15, 2, 1, "", "set_flag"], [15, 2, 1, "", "set_hybrid_mbr"], [15, 2, 1, "", "set_mbr"], [15, 2, 1, "", "set_uuid"]], "kiwi.partitioner.msdos": [[15, 1, 1, "", "PartitionerMsDos"]], "kiwi.partitioner.msdos.PartitionerMsDos": [[15, 2, 1, "", "create"], [15, 2, 1, "", "post_init"], [15, 2, 1, "", "resize_table"], [15, 2, 1, "", "set_flag"], [15, 2, 1, "", "set_start_sector"], [15, 2, 1, "", "set_uuid"]], "kiwi.path": [[1, 1, 1, "", "Path"]], "kiwi.path.Path": [[1, 2, 1, "", "access"], [1, 2, 1, "", "create"], [1, 2, 1, "", "move_to_root"], [1, 2, 1, "", "rebase_to_root"], [1, 2, 1, "", "remove_hierarchy"], [1, 2, 1, "", "sort_by_hierarchy"], [1, 2, 1, "", "which"], [1, 2, 1, "", "wipe"]], "kiwi.privileges": [[1, 1, 1, "", "Privileges"]], "kiwi.privileges.Privileges": [[1, 2, 1, "", "check_for_root_permissions"]], "kiwi.repository": [[16, 1, 1, "", "Repository"], [16, 0, 0, "-", "base"], [16, 0, 0, "-", "dnf4"], [17, 0, 0, "-", "template"], [16, 0, 0, "-", "zypper"]], "kiwi.repository.Repository": [[16, 2, 1, "", "new"]], "kiwi.repository.base": [[16, 1, 1, "", "RepositoryBase"]], "kiwi.repository.base.RepositoryBase": [[16, 2, 1, "", "add_repo"], [16, 2, 1, "", "cleanup"], [16, 2, 1, "", "cleanup_unused_repos"], [16, 2, 1, "", "delete_all_repos"], [16, 2, 1, "", "delete_repo"], [16, 2, 1, "", "delete_repo_cache"], [16, 2, 1, "", "import_trusted_keys"], [16, 2, 1, "", "post_init"], [16, 2, 1, "", "run_repo_customize"], [16, 2, 1, "", "runtime_config"], [16, 2, 1, "", "setup_package_database_configuration"], [16, 2, 1, "", "use_default_location"]], "kiwi.repository.dnf4": [[16, 1, 1, "", "RepositoryDnf4"]], "kiwi.repository.dnf4.RepositoryDnf4": [[16, 2, 1, "", "add_repo"], [16, 2, 1, "", "cleanup"], [16, 2, 1, "", "cleanup_unused_repos"], [16, 2, 1, "", "delete_all_repos"], [16, 2, 1, "", "delete_repo"], [16, 2, 1, "", "delete_repo_cache"], [16, 2, 1, "", "import_trusted_keys"], [16, 2, 1, "", "post_init"], [16, 2, 1, "", "runtime_config"], [16, 2, 1, "", "setup_package_database_configuration"], [16, 2, 1, "", "use_default_location"]], "kiwi.repository.template": [[17, 0, 0, "-", "apt"]], "kiwi.repository.template.apt": [[17, 1, 1, "", "PackageManagerTemplateAptGet"]], "kiwi.repository.template.apt.PackageManagerTemplateAptGet": [[17, 2, 1, "", "get_host_template"], [17, 2, 1, "", "get_image_template"]], "kiwi.repository.zypper": [[16, 1, 1, "", "RepositoryZypper"]], "kiwi.repository.zypper.RepositoryZypper": [[16, 2, 1, "", "add_repo"], [16, 2, 1, "", "cleanup"], [16, 2, 1, "", "cleanup_unused_repos"], [16, 2, 1, "", "delete_all_repos"], [16, 2, 1, "", "delete_repo"], [16, 2, 1, "", "delete_repo_cache"], [16, 2, 1, "", "import_trusted_keys"], [16, 2, 1, "", "post_init"], [16, 2, 1, "", "runtime_config"], [16, 2, 1, "", "setup_package_database_configuration"], [16, 2, 1, "", "use_default_location"]], "kiwi.runtime_checker": [[1, 1, 1, "", "RuntimeChecker"], [1, 1, 1, "", "dracut_module_type"]], "kiwi.runtime_checker.RuntimeChecker": [[1, 2, 1, "", "check_appx_naming_conventions_valid"], [1, 2, 1, "", "check_boot_description_exists"], [1, 2, 1, "", "check_consistent_kernel_in_boot_and_system_image"], [1, 2, 1, "", "check_container_tool_chain_installed"], [1, 2, 1, "", "check_dracut_module_for_disk_oem_in_package_list"], [1, 2, 1, "", "check_dracut_module_for_disk_overlay_in_package_list"], [1, 2, 1, "", "check_dracut_module_for_live_iso_in_package_list"], [1, 2, 1, "", "check_dracut_module_for_oem_install_in_package_list"], [1, 2, 1, "", "check_dracut_module_versions_compatible_to_kiwi"], [1, 2, 1, "", "check_efi_fat_image_has_correct_size"], [1, 2, 1, "", "check_efi_mode_for_disk_overlay_correctly_setup"], [1, 2, 1, "", "check_image_include_repos_publicly_resolvable"], [1, 2, 1, "", "check_image_type_unique"], [1, 2, 1, "", "check_image_version_provided"], [1, 2, 1, "", "check_include_references_unresolvable"], [1, 2, 1, "", "check_initrd_selection_required"], [1, 2, 1, "", "check_luksformat_options_valid"], [1, 2, 1, "", "check_mediacheck_installed"], [1, 2, 1, "", "check_partuuid_persistency_type_used_with_mbr"], [1, 2, 1, "", "check_repositories_configured"], [1, 2, 1, "", "check_swap_name_used_with_lvm"], [1, 2, 1, "", "check_target_directory_not_in_shared_cache"], [1, 2, 1, "", "check_volume_label_used_with_lvm"], [1, 2, 1, "", "check_volume_setup_defines_multiple_fullsize_volumes"], [1, 2, 1, "", "check_volume_setup_defines_reserved_labels"], [1, 2, 1, "", "check_volume_setup_has_no_root_definition"], [1, 2, 1, "", "check_xen_uniquely_setup_as_server_or_guest"]], "kiwi.runtime_checker.dracut_module_type": [[1, 3, 1, "", "min_version"], [1, 3, 1, "", "package"]], "kiwi.runtime_config": [[1, 1, 1, "", "RuntimeConfig"]], "kiwi.runtime_config.RuntimeConfig": [[1, 2, 1, "", "get_bundle_compression"], [1, 2, 1, "", "get_container_compression"], [1, 2, 1, "", "get_credentials_verification_metadata_signing_key_file"], [1, 2, 1, "", "get_disabled_runtime_checks"], [1, 2, 1, "", "get_iso_media_tag_tool"], [1, 2, 1, "", "get_iso_tool_category"], [1, 2, 1, "", "get_mapper_tool"], [1, 2, 1, "", "get_max_size_constraint"], [1, 2, 1, "", "get_obs_api_credentials"], [1, 2, 1, "", "get_obs_api_server_url"], [1, 2, 1, "", "get_obs_download_server_url"], [1, 2, 1, "", "get_oci_archive_tool"], [1, 2, 1, "", "get_package_changes"], [1, 2, 1, "", "get_xz_options"], [1, 2, 1, "", "is_obs_public"]], "kiwi.solver": [[19, 0, 0, "-", "repository"], [18, 0, 0, "-", "sat"]], "kiwi.solver.repository": [[19, 1, 1, "", "SolverRepository"], [19, 0, 0, "-", "base"], [19, 0, 0, "-", "rpm_dir"], [19, 0, 0, "-", "rpm_md"], [19, 0, 0, "-", "suse"]], "kiwi.solver.repository.SolverRepository": [[19, 2, 1, "", "new"]], "kiwi.solver.repository.base": [[19, 1, 1, "", "SolverRepositoryBase"]], "kiwi.solver.repository.base.SolverRepositoryBase": [[19, 2, 1, "", "create_repository_solvable"], [19, 2, 1, "", "download_from_repository"], [19, 2, 1, "", "get_repo_type"], [19, 2, 1, "", "is_uptodate"], [19, 2, 1, "", "timestamp"]], "kiwi.solver.repository.rpm_dir": [[19, 1, 1, "", "SolverRepositoryRpmDir"]], "kiwi.solver.repository.rpm_md": [[19, 1, 1, "", "SolverRepositoryRpmMd"]], "kiwi.solver.repository.rpm_md.SolverRepositoryRpmMd": [[19, 2, 1, "", "timestamp"]], "kiwi.solver.repository.suse": [[19, 1, 1, "", "SolverRepositorySUSE"]], "kiwi.solver.sat": [[18, 1, 1, "", "Sat"]], "kiwi.solver.sat.Sat": [[18, 2, 1, "", "add_repository"], [18, 2, 1, "", "set_dist_type"], [18, 2, 1, "", "solve"]], "kiwi.storage": [[20, 0, 0, "-", "clone_device"], [20, 0, 0, "-", "device_provider"], [20, 0, 0, "-", "disk"], [20, 0, 0, "-", "loop_device"], [20, 0, 0, "-", "luks_device"], [20, 0, 0, "-", "mapped_device"], [20, 0, 0, "-", "raid_device"], [20, 0, 0, "-", "setup"], [21, 0, 0, "-", "subformat"]], "kiwi.storage.clone_device": [[20, 1, 1, "", "CloneDevice"]], "kiwi.storage.clone_device.CloneDevice": [[20, 2, 1, "", "clone"]], "kiwi.storage.device_provider": [[20, 1, 1, "", "DeviceProvider"]], "kiwi.storage.device_provider.DeviceProvider": [[20, 2, 1, "", "get_byte_size"], [20, 2, 1, "", "get_device"], [20, 2, 1, "", "get_uuid"], [20, 2, 1, "", "is_loop"]], "kiwi.storage.disk": [[20, 1, 1, "", "Disk"], [20, 1, 1, "", "ptable_entry_type"]], "kiwi.storage.disk.Disk": [[20, 2, 1, "", "activate_boot_partition"], [20, 2, 1, "", "create_boot_partition"], [20, 2, 1, "", "create_custom_partitions"], [20, 2, 1, "", "create_efi_csm_partition"], [20, 2, 1, "", "create_efi_partition"], [20, 2, 1, "", "create_hybrid_mbr"], [20, 2, 1, "", "create_mbr"], [20, 2, 1, "", "create_prep_partition"], [20, 2, 1, "", "create_root_lvm_partition"], [20, 2, 1, "", "create_root_partition"], [20, 2, 1, "", "create_root_raid_partition"], [20, 2, 1, "", "create_root_readonly_partition"], [20, 2, 1, "", "create_spare_partition"], [20, 2, 1, "", "create_swap_partition"], [20, 3, 1, "", "gUID"], [20, 2, 1, "", "get_device"], [20, 2, 1, "", "get_discoverable_partition_ids"], [20, 2, 1, "", "get_public_partition_id_map"], [20, 2, 1, "", "is_loop"], [20, 2, 1, "", "map_partitions"], [20, 3, 1, "", "protected_map_ids"], [20, 2, 1, "", "set_start_sector"], [20, 3, 1, "", "storage_provider"], [20, 2, 1, "", "wipe"]], "kiwi.storage.disk.ptable_entry_type": [[20, 3, 1, "", "clone"], [20, 3, 1, "", "filesystem"], [20, 3, 1, "", "mbsize"], [20, 3, 1, "", "mountpoint"], [20, 3, 1, "", "partition_name"], [20, 3, 1, "", "partition_type"]], "kiwi.storage.loop_device": [[20, 1, 1, "", "LoopDevice"]], "kiwi.storage.loop_device.LoopDevice": [[20, 2, 1, "", "create"], [20, 2, 1, "", "get_device"], [20, 2, 1, "", "is_loop"]], "kiwi.storage.luks_device": [[20, 1, 1, "", "LuksDevice"]], "kiwi.storage.luks_device.LuksDevice": [[20, 2, 1, "", "create_crypto_luks"], [20, 2, 1, "", "create_crypttab"], [20, 2, 1, "", "create_random_keyfile"], [20, 2, 1, "", "get_device"], [20, 2, 1, "", "is_loop"], [20, 3, 1, "", "storage_provider"]], "kiwi.storage.mapped_device": [[20, 1, 1, "", "MappedDevice"]], "kiwi.storage.mapped_device.MappedDevice": [[20, 2, 1, "", "get_device"], [20, 2, 1, "", "is_loop"]], "kiwi.storage.raid_device": [[20, 1, 1, "", "RaidDevice"]], "kiwi.storage.raid_device.RaidDevice": [[20, 2, 1, "", "create_degraded_raid"], [20, 2, 1, "", "create_raid_config"], [20, 2, 1, "", "get_device"], [20, 2, 1, "", "is_loop"], [20, 3, 1, "", "storage_provider"]], "kiwi.storage.setup": [[20, 1, 1, "", "DiskSetup"]], "kiwi.storage.setup.DiskSetup": [[20, 2, 1, "", "boot_partition_size"], [20, 2, 1, "", "get_boot_label"], [20, 2, 1, "", "get_disksize_mbytes"], [20, 2, 1, "", "get_efi_label"], [20, 2, 1, "", "get_root_label"], [20, 2, 1, "", "need_boot_partition"]], "kiwi.storage.subformat": [[21, 1, 1, "", "DiskFormat"], [21, 0, 0, "-", "base"], [21, 0, 0, "-", "gce"], [21, 0, 0, "-", "ova"], [21, 0, 0, "-", "qcow2"], [22, 0, 0, "-", "template"], [21, 0, 0, "-", "vagrant_base"], [21, 0, 0, "-", "vagrant_libvirt"], [21, 0, 0, "-", "vagrant_virtualbox"], [21, 0, 0, "-", "vdi"], [21, 0, 0, "-", "vhd"], [21, 0, 0, "-", "vhdfixed"], [21, 0, 0, "-", "vhdx"], [21, 0, 0, "-", "vmdk"]], "kiwi.storage.subformat.DiskFormat": [[21, 2, 1, "", "new"]], "kiwi.storage.subformat.base": [[21, 1, 1, "", "DiskFormatBase"]], "kiwi.storage.subformat.base.DiskFormatBase": [[21, 2, 1, "", "create_image_format"], [21, 2, 1, "", "get_qemu_option_list"], [21, 2, 1, "", "get_target_file_path_for_format"], [21, 2, 1, "", "has_raw_disk"], [21, 2, 1, "", "post_init"], [21, 2, 1, "", "resize_raw_disk"], [21, 2, 1, "", "store_to_result"]], "kiwi.storage.subformat.gce": [[21, 1, 1, "", "DiskFormatGce"]], "kiwi.storage.subformat.gce.DiskFormatGce": [[21, 2, 1, "", "create_image_format"], [21, 2, 1, "", "get_target_file_path_for_format"], [21, 2, 1, "", "post_init"], [21, 2, 1, "", "store_to_result"]], "kiwi.storage.subformat.ova": [[21, 1, 1, "", "DiskFormatOva"]], "kiwi.storage.subformat.ova.DiskFormatOva": [[21, 2, 1, "", "create_image_format"], [21, 2, 1, "", "post_init"], [21, 2, 1, "", "store_to_result"]], "kiwi.storage.subformat.qcow2": [[21, 1, 1, "", "DiskFormatQcow2"]], "kiwi.storage.subformat.qcow2.DiskFormatQcow2": [[21, 2, 1, "", "create_image_format"], [21, 2, 1, "", "post_init"], [21, 2, 1, "", "store_to_result"]], "kiwi.storage.subformat.template": [[22, 0, 0, "-", "vagrant_config"], [22, 0, 0, "-", "virtualbox_ovf"], [22, 0, 0, "-", "vmware_settings"]], "kiwi.storage.subformat.template.vagrant_config": [[22, 1, 1, "", "VagrantConfigTemplate"]], "kiwi.storage.subformat.template.vagrant_config.VagrantConfigTemplate": [[22, 2, 1, "", "get_template"]], "kiwi.storage.subformat.template.virtualbox_ovf": [[22, 1, 1, "", "VirtualboxOvfTemplate"]], "kiwi.storage.subformat.template.virtualbox_ovf.VirtualboxOvfTemplate": [[22, 2, 1, "", "get_template"]], "kiwi.storage.subformat.template.vmware_settings": [[22, 1, 1, "", "VmwareSettingsTemplate"]], "kiwi.storage.subformat.template.vmware_settings.VmwareSettingsTemplate": [[22, 2, 1, "", "get_template"]], "kiwi.storage.subformat.vagrant_base": [[21, 1, 1, "", "DiskFormatVagrantBase"]], "kiwi.storage.subformat.vagrant_base.DiskFormatVagrantBase": [[21, 2, 1, "", "create_box_img"], [21, 2, 1, "", "create_image_format"], [21, 2, 1, "", "get_additional_metadata"], [21, 2, 1, "", "get_additional_vagrant_config_settings"], [21, 2, 1, "", "post_init"], [21, 2, 1, "", "store_to_result"], [21, 2, 1, "", "vagrant_post_init"]], "kiwi.storage.subformat.vagrant_libvirt": [[21, 1, 1, "", "DiskFormatVagrantLibVirt"]], "kiwi.storage.subformat.vagrant_libvirt.DiskFormatVagrantLibVirt": [[21, 2, 1, "", "create_box_img"], [21, 2, 1, "", "get_additional_metadata"], [21, 2, 1, "", "get_additional_vagrant_config_settings"], [21, 2, 1, "", "vagrant_post_init"]], "kiwi.storage.subformat.vagrant_virtualbox": [[21, 1, 1, "", "DiskFormatVagrantVirtualBox"]], "kiwi.storage.subformat.vagrant_virtualbox.DiskFormatVagrantVirtualBox": [[21, 2, 1, "", "create_box_img"], [21, 2, 1, "", "get_additional_vagrant_config_settings"], [21, 2, 1, "", "vagrant_post_init"]], "kiwi.storage.subformat.vdi": [[21, 1, 1, "", "DiskFormatVdi"]], "kiwi.storage.subformat.vdi.DiskFormatVdi": [[21, 2, 1, "", "create_image_format"], [21, 2, 1, "", "post_init"]], "kiwi.storage.subformat.vhd": [[21, 1, 1, "", "DiskFormatVhd"]], "kiwi.storage.subformat.vhd.DiskFormatVhd": [[21, 2, 1, "", "create_image_format"], [21, 2, 1, "", "post_init"]], "kiwi.storage.subformat.vhdfixed": [[21, 1, 1, "", "DiskFormatVhdFixed"]], "kiwi.storage.subformat.vhdfixed.DiskFormatVhdFixed": [[21, 2, 1, "", "create_image_format"], [21, 2, 1, "", "post_init"], [21, 2, 1, "", "store_to_result"]], "kiwi.storage.subformat.vhdx": [[21, 1, 1, "", "DiskFormatVhdx"]], "kiwi.storage.subformat.vhdx.DiskFormatVhdx": [[21, 2, 1, "", "create_image_format"], [21, 2, 1, "", "post_init"]], "kiwi.storage.subformat.vmdk": [[21, 1, 1, "", "DiskFormatVmdk"]], "kiwi.storage.subformat.vmdk.DiskFormatVmdk": [[21, 2, 1, "", "create_image_format"], [21, 2, 1, "", "post_init"], [21, 2, 1, "", "store_to_result"]], "kiwi.system": [[23, 0, 0, "-", "identifier"], [23, 0, 0, "-", "kernel"], [23, 0, 0, "-", "prepare"], [23, 0, 0, "-", "profile"], [23, 0, 0, "-", "result"], [23, 0, 0, "-", "root_bind"], [23, 0, 0, "-", "root_init"], [23, 0, 0, "-", "setup"], [23, 0, 0, "-", "shell"], [23, 0, 0, "-", "size"], [23, 0, 0, "-", "uri"], [23, 0, 0, "-", "users"]], "kiwi.system.identifier": [[23, 1, 1, "", "SystemIdentifier"]], "kiwi.system.identifier.SystemIdentifier": [[23, 2, 1, "", "calculate_id"], [23, 2, 1, "", "get_id"], [23, 2, 1, "", "write"], [23, 2, 1, "", "write_to_disk"]], "kiwi.system.kernel": [[23, 1, 1, "", "Kernel"], [23, 1, 1, "", "kernel_type"], [23, 1, 1, "", "xen_hypervisor_type"]], "kiwi.system.kernel.Kernel": [[23, 2, 1, "", "copy_kernel"], [23, 2, 1, "", "copy_xen_hypervisor"], [23, 2, 1, "", "get_kernel"], [23, 2, 1, "", "get_xen_hypervisor"]], "kiwi.system.kernel.kernel_type": [[23, 3, 1, "", "filename"], [23, 3, 1, "", "name"], [23, 3, 1, "", "version"]], "kiwi.system.kernel.xen_hypervisor_type": [[23, 3, 1, "", "filename"], [23, 3, 1, "", "name"]], "kiwi.system.prepare": [[23, 1, 1, "", "SystemPrepare"]], "kiwi.system.prepare.SystemPrepare": [[23, 2, 1, "", "clean_package_manager_leftovers"], [23, 2, 1, "", "delete_packages"], [23, 2, 1, "", "install_bootstrap"], [23, 2, 1, "", "install_packages"], [23, 2, 1, "", "install_system"], [23, 2, 1, "", "pinch_system"], [23, 2, 1, "", "setup_repositories"], [23, 2, 1, "", "update_system"], [23, 3, 1, "", "uri_list"]], "kiwi.system.profile": [[23, 1, 1, "", "Profile"]], "kiwi.system.profile.Profile": [[23, 2, 1, "", "add"], [23, 2, 1, "", "create"], [23, 2, 1, "", "delete"], [23, 2, 1, "", "get_settings"]], "kiwi.system.result": [[23, 1, 1, "", "Result"], [23, 1, 1, "", "result_file_type"], [23, 1, 1, "", "result_name_tags"]], "kiwi.system.result.Result": [[23, 2, 1, "", "add"], [23, 2, 1, "", "add_bundle_format"], [23, 2, 1, "", "dump"], [23, 2, 1, "", "get_results"], [23, 2, 1, "", "load"], [23, 2, 1, "", "print_results"], [23, 2, 1, "", "verify_image_size"]], "kiwi.system.result.result_file_type": [[23, 3, 1, "", "compress"], [23, 3, 1, "", "filename"], [23, 3, 1, "", "shasum"], [23, 3, 1, "", "use_for_bundle"]], "kiwi.system.result.result_name_tags": [[23, 3, 1, "", "A"], [23, 3, 1, "", "I"], [23, 3, 1, "", "M"], [23, 3, 1, "", "N"], [23, 3, 1, "", "P"], [23, 3, 1, "", "T"], [23, 3, 1, "", "m"], [23, 3, 1, "", "p"], [23, 3, 1, "", "v"]], "kiwi.system.root_bind": [[23, 1, 1, "", "RootBind"]], "kiwi.system.root_bind.RootBind": [[23, 2, 1, "", "cleanup"], [23, 2, 1, "", "mount_kernel_file_systems"], [23, 2, 1, "", "mount_shared_directory"], [23, 2, 1, "", "setup_intermediate_config"], [23, 2, 1, "", "umount_kernel_file_systems"]], "kiwi.system.root_init": [[23, 1, 1, "", "RootInit"]], "kiwi.system.root_init.RootInit": [[23, 2, 1, "", "create"], [23, 2, 1, "", "delete"]], "kiwi.system.setup": [[23, 1, 1, "", "SystemSetup"]], "kiwi.system.setup.SystemSetup": [[23, 2, 1, "", "call_config_host_overlay_script"], [23, 2, 1, "", "call_config_overlay_script"], [23, 2, 1, "", "call_config_script"], [23, 2, 1, "", "call_disk_script"], [23, 2, 1, "", "call_edit_boot_config_script"], [23, 2, 1, "", "call_edit_boot_install_script"], [23, 2, 1, "", "call_image_script"], [23, 2, 1, "", "call_post_bootstrap_script"], [23, 2, 1, "", "call_pre_disk_script"], [23, 2, 1, "", "cleanup"], [23, 2, 1, "", "create_fstab"], [23, 2, 1, "", "create_init_link_from_linuxrc"], [23, 2, 1, "", "create_recovery_archive"], [23, 2, 1, "", "export_modprobe_setup"], [23, 2, 1, "", "export_package_changes"], [23, 2, 1, "", "export_package_list"], [23, 2, 1, "", "export_package_verification"], [23, 2, 1, "", "import_cdroot_files"], [23, 2, 1, "", "import_description"], [23, 2, 1, "", "import_files"], [23, 2, 1, "", "import_image_identifier"], [23, 2, 1, "", "import_overlay_files"], [23, 2, 1, "", "import_repositories_marked_as_imageinclude"], [23, 2, 1, "", "script_exists"], [23, 2, 1, "", "set_selinux_file_contexts"], [23, 2, 1, "", "setup_groups"], [23, 2, 1, "", "setup_keyboard_map"], [23, 2, 1, "", "setup_locale"], [23, 2, 1, "", "setup_machine_id"], [23, 2, 1, "", "setup_permissions"], [23, 2, 1, "", "setup_plymouth_splash"], [23, 2, 1, "", "setup_registry_import"], [23, 2, 1, "", "setup_selinux_file_contexts"], [23, 2, 1, "", "setup_timezone"], [23, 2, 1, "", "setup_users"]], "kiwi.system.shell": [[23, 1, 1, "", "Shell"]], "kiwi.system.shell.Shell": [[23, 2, 1, "", "format_to_variable_value"], [23, 2, 1, "", "quote"], [23, 2, 1, "", "quote_key_value_file"], [23, 2, 1, "", "run_common_function"]], "kiwi.system.size": [[23, 1, 1, "", "SystemSize"]], "kiwi.system.size.SystemSize": [[23, 2, 1, "", "accumulate_files"], [23, 2, 1, "", "accumulate_mbyte_file_sizes"], [23, 2, 1, "", "customize"]], "kiwi.system.uri": [[23, 1, 1, "", "Uri"]], "kiwi.system.uri.Uri": [[23, 2, 1, "", "alias"], [23, 2, 1, "", "credentials_file_name"], [23, 2, 1, "", "get_fragment"], [23, 2, 1, "", "is_public"], [23, 2, 1, "", "is_remote"], [23, 2, 1, "", "print_sensitive"], [23, 2, 1, "", "translate"]], "kiwi.system.users": [[23, 1, 1, "", "Users"]], "kiwi.system.users.Users": [[23, 2, 1, "", "group_add"], [23, 2, 1, "", "group_exists"], [23, 2, 1, "", "setup_home_for_user"], [23, 2, 1, "", "user_add"], [23, 2, 1, "", "user_exists"], [23, 2, 1, "", "user_modify"]], "kiwi.tasks": [[24, 0, 0, "-", "base"], [24, 0, 0, "-", "result_bundle"], [24, 0, 0, "-", "result_list"], [24, 0, 0, "-", "system_build"], [24, 0, 0, "-", "system_create"], [24, 0, 0, "-", "system_prepare"], [24, 0, 0, "-", "system_update"]], "kiwi.tasks.base": [[24, 1, 1, "", "CliTask"]], "kiwi.tasks.base.CliTask": [[24, 2, 1, "", "attr_token"], [24, 2, 1, "", "load_xml_description"], [24, 2, 1, "", "quadruple_token"], [24, 2, 1, "", "run_checks"], [24, 2, 1, "", "tentuple_token"]], "kiwi.tasks.result_bundle": [[24, 1, 1, "", "ResultBundleTask"]], "kiwi.tasks.result_bundle.ResultBundleTask": [[24, 2, 1, "", "process"]], "kiwi.tasks.result_list": [[24, 1, 1, "", "ResultListTask"]], "kiwi.tasks.result_list.ResultListTask": [[24, 2, 1, "", "process"]], "kiwi.tasks.system_build": [[24, 1, 1, "", "SystemBuildTask"]], "kiwi.tasks.system_build.SystemBuildTask": [[24, 2, 1, "", "process"]], "kiwi.tasks.system_create": [[24, 1, 1, "", "SystemCreateTask"]], "kiwi.tasks.system_create.SystemCreateTask": [[24, 2, 1, "", "process"]], "kiwi.tasks.system_prepare": [[24, 1, 1, "", "SystemPrepareTask"]], "kiwi.tasks.system_prepare.SystemPrepareTask": [[24, 2, 1, "", "process"]], "kiwi.tasks.system_update": [[24, 1, 1, "", "SystemUpdateTask"]], "kiwi.tasks.system_update.SystemUpdateTask": [[24, 2, 1, "", "process"]], "kiwi.utils": [[25, 0, 0, "-", "block"], [25, 0, 0, "-", "checksum"], [25, 0, 0, "-", "compress"], [25, 0, 0, "-", "sync"], [25, 0, 0, "-", "sysconfig"]], "kiwi.utils.block": [[25, 1, 1, "", "BlockID"]], "kiwi.utils.block.BlockID": [[25, 2, 1, "", "get_blkid"], [25, 2, 1, "", "get_filesystem"], [25, 2, 1, "", "get_label"], [25, 2, 1, "", "get_partition_count"], [25, 2, 1, "", "get_uuid"]], "kiwi.utils.checksum": [[25, 1, 1, "", "Checksum"]], "kiwi.utils.checksum.Checksum": [[25, 2, 1, "", "matches"], [25, 2, 1, "", "md5"], [25, 2, 1, "", "sha256"]], "kiwi.utils.compress": [[25, 1, 1, "", "Compress"]], "kiwi.utils.compress.Compress": [[25, 2, 1, "", "get_format"], [25, 2, 1, "", "gzip"], [25, 2, 1, "", "uncompress"], [25, 2, 1, "", "xz"]], "kiwi.utils.sync": [[25, 1, 1, "", "DataSync"]], "kiwi.utils.sync.DataSync": [[25, 2, 1, "", "sync_data"], [25, 2, 1, "", "target_supports_extended_attributes"]], "kiwi.utils.sysconfig": [[25, 1, 1, "", "SysConfig"]], "kiwi.utils.sysconfig.SysConfig": [[25, 2, 1, "", "get"], [25, 2, 1, "", "write"]], "kiwi.volume_manager": [[26, 1, 1, "", "VolumeManager"], [26, 0, 0, "-", "base"], [26, 0, 0, "-", "btrfs"], [26, 0, 0, "-", "lvm"]], "kiwi.volume_manager.VolumeManager": [[26, 2, 1, "", "new"]], "kiwi.volume_manager.base": [[26, 1, 1, "", "VolumeManagerBase"]], "kiwi.volume_manager.base.VolumeManagerBase": [[26, 2, 1, "", "apply_attributes_on_volume"], [26, 2, 1, "", "create_verification_metadata"], [26, 2, 1, "", "create_verity_layer"], [26, 2, 1, "", "create_volume_paths_in_root_dir"], [26, 2, 1, "", "create_volumes"], [26, 3, 1, "", "custom_args"], [26, 3, 1, "", "custom_filesystem_args"], [26, 3, 1, "", "device"], [26, 3, 1, "", "device_map"], [26, 3, 1, "", "device_provider_root"], [26, 2, 1, "", "get_canonical_volume_list"], [26, 2, 1, "", "get_device"], [26, 2, 1, "", "get_fstab"], [26, 2, 1, "", "get_mountpoint"], [26, 2, 1, "", "get_root_volume_name"], [26, 2, 1, "", "get_volume_mbsize"], [26, 2, 1, "", "get_volumes"], [26, 2, 1, "", "is_loop"], [26, 2, 1, "", "mount"], [26, 3, 1, "", "mount_list"], [26, 2, 1, "", "mount_volumes"], [26, 3, 1, "", "mountpoint"], [26, 2, 1, "", "post_init"], [26, 3, 1, "", "root_dir"], [26, 2, 1, "", "set_property_readonly_root"], [26, 2, 1, "", "setup"], [26, 2, 1, "", "setup_mountpoint"], [26, 2, 1, "", "sync_data"], [26, 2, 1, "", "umount"], [26, 2, 1, "", "umount_volumes"], [26, 3, 1, "", "volume_group"], [26, 3, 1, "", "volume_map"], [26, 3, 1, "", "volumes"]], "kiwi.volume_manager.btrfs": [[26, 1, 1, "", "VolumeManagerBtrfs"]], "kiwi.volume_manager.btrfs.VolumeManagerBtrfs": [[26, 2, 1, "", "create_volumes"], [26, 2, 1, "", "get_fstab"], [26, 2, 1, "", "get_mountpoint"], [26, 2, 1, "", "get_root_volume_name"], [26, 2, 1, "", "get_volumes"], [26, 2, 1, "", "mount_volumes"], [26, 2, 1, "", "post_init"], [26, 2, 1, "", "set_property_readonly_root"], [26, 2, 1, "", "setup"], [26, 2, 1, "", "sync_data"], [26, 2, 1, "", "umount_volumes"]], "kiwi.volume_manager.lvm": [[26, 1, 1, "", "VolumeManagerLVM"]], "kiwi.volume_manager.lvm.VolumeManagerLVM": [[26, 2, 1, "", "create_volumes"], [26, 2, 1, "", "get_device"], [26, 2, 1, "", "get_fstab"], [26, 2, 1, "", "get_volumes"], [26, 2, 1, "", "mount_volumes"], [26, 2, 1, "", "post_init"], [26, 2, 1, "", "setup"], [26, 2, 1, "", "umount_volumes"]], "kiwi.xml_description": [[1, 1, 1, "", "XMLDescription"]], "kiwi.xml_description.XMLDescription": [[1, 2, 1, "", "get_extension_xml_data"], [1, 2, 1, "", "load"]], "kiwi.xml_state": [[1, 1, 1, "", "ContainerT"], [1, 1, 1, "", "FileT"], [1, 1, 1, "", "XMLState"], [1, 1, 1, "", "description_type"], [1, 1, 1, "", "package_type"], [1, 1, 1, "", "size_type"], [1, 1, 1, "", "volume_type"]], "kiwi.xml_state.ContainerT": [[1, 3, 1, "", "backend"], [1, 3, 1, "", "container_file"], [1, 3, 1, "", "fetch_command"], [1, 3, 1, "", "fetch_only"], [1, 3, 1, "", "load_command"], [1, 3, 1, "", "name"]], "kiwi.xml_state.FileT": [[1, 3, 1, "", "owner"], [1, 3, 1, "", "permissions"], [1, 3, 1, "", "target"]], "kiwi.xml_state.XMLState": [[1, 2, 1, "", "add_container_config_label"], [1, 2, 1, "", "add_repository"], [1, 2, 1, "", "btrfs_default_volume_requested"], [1, 2, 1, "", "collection_matches_host_architecture"], [1, 2, 1, "", "container_matches_host_architecture"], [1, 2, 1, "", "containers_matches_host_architecture"], [1, 2, 1, "", "copy_bootdelete_packages"], [1, 2, 1, "", "copy_bootincluded_archives"], [1, 2, 1, "", "copy_bootincluded_packages"], [1, 2, 1, "", "copy_bootloader_section"], [1, 2, 1, "", "copy_build_type_attributes"], [1, 2, 1, "", "copy_displayname"], [1, 2, 1, "", "copy_drivers_sections"], [1, 2, 1, "", "copy_machine_section"], [1, 2, 1, "", "copy_name"], [1, 2, 1, "", "copy_oemconfig_section"], [1, 2, 1, "", "copy_preferences_subsections"], [1, 2, 1, "", "copy_repository_sections"], [1, 2, 1, "", "copy_strip_sections"], [1, 2, 1, "", "copy_systemdisk_section"], [1, 2, 1, "", "delete_repository_sections"], [1, 2, 1, "", "delete_repository_sections_used_for_build"], [1, 2, 1, "", "get_archives_target_dirs"], [1, 2, 1, "", "get_bootloader_config_options"], [1, 2, 1, "", "get_bootloader_install_options"], [1, 2, 1, "", "get_bootloader_options"], [1, 2, 1, "", "get_bootloader_shim_options"], [1, 2, 1, "", "get_bootstrap_archives"], [1, 2, 1, "", "get_bootstrap_archives_target_dirs"], [1, 2, 1, "", "get_bootstrap_collection_type"], [1, 2, 1, "", "get_bootstrap_collections"], [1, 2, 1, "", "get_bootstrap_files"], [1, 2, 1, "", "get_bootstrap_ignore_packages"], [1, 2, 1, "", "get_bootstrap_package_name"], [1, 2, 1, "", "get_bootstrap_packages"], [1, 2, 1, "", "get_bootstrap_packages_sections"], [1, 2, 1, "", "get_bootstrap_products"], [1, 2, 1, "", "get_build_type_bootloader_bls"], [1, 2, 1, "", "get_build_type_bootloader_console"], [1, 2, 1, "", "get_build_type_bootloader_name"], [1, 2, 1, "", "get_build_type_bootloader_section"], [1, 2, 1, "", "get_build_type_bootloader_securelinux_section"], [1, 2, 1, "", "get_build_type_bootloader_serial_line_setup"], [1, 2, 1, "", "get_build_type_bootloader_settings_section"], [1, 2, 1, "", "get_build_type_bootloader_targettype"], [1, 2, 1, "", "get_build_type_bootloader_timeout"], [1, 2, 1, "", "get_build_type_bootloader_timeout_style"], [1, 2, 1, "", "get_build_type_bootloader_use_disk_password"], [1, 2, 1, "", "get_build_type_bundle_format"], [1, 2, 1, "", "get_build_type_containerconfig_section"], [1, 2, 1, "", "get_build_type_format_options"], [1, 2, 1, "", "get_build_type_machine_section"], [1, 2, 1, "", "get_build_type_name"], [1, 2, 1, "", "get_build_type_oemconfig_section"], [1, 2, 1, "", "get_build_type_partitions_section"], [1, 2, 1, "", "get_build_type_size"], [1, 2, 1, "", "get_build_type_spare_part_fs_attributes"], [1, 2, 1, "", "get_build_type_spare_part_size"], [1, 2, 1, "", "get_build_type_system_disk_section"], [1, 2, 1, "", "get_build_type_unpartitioned_bytes"], [1, 2, 1, "", "get_build_type_vagrant_config_section"], [1, 2, 1, "", "get_build_type_vmconfig_entries"], [1, 2, 1, "", "get_build_type_vmdisk_section"], [1, 2, 1, "", "get_build_type_vmdvd_section"], [1, 2, 1, "", "get_build_type_vmnic_entries"], [1, 2, 1, "", "get_collection_modules"], [1, 2, 1, "", "get_collection_type"], [1, 2, 1, "", "get_collections"], [1, 2, 1, "", "get_container_config"], [1, 2, 1, "", "get_containers"], [1, 2, 1, "", "get_containers_sections"], [1, 2, 1, "", "get_derived_from_image_uri"], [1, 2, 1, "", "get_description_section"], [1, 2, 1, "", "get_disk_start_sector"], [1, 2, 1, "", "get_distribution_name_from_boot_attribute"], [1, 2, 1, "", "get_drivers_list"], [1, 2, 1, "", "get_fs_create_option_list"], [1, 2, 1, "", "get_fs_mount_option_list"], [1, 2, 1, "", "get_host_key_certificates"], [1, 2, 1, "", "get_ignore_packages"], [1, 2, 1, "", "get_image_packages_sections"], [1, 2, 1, "", "get_image_version"], [1, 2, 1, "", "get_include_section_reference_file_names"], [1, 2, 1, "", "get_initrd_system"], [1, 2, 1, "", "get_installmedia_initrd_modules"], [1, 2, 1, "", "get_locale"], [1, 2, 1, "", "get_luks_credentials"], [1, 2, 1, "", "get_luks_format_options"], [1, 2, 1, "", "get_oemconfig_oem_multipath_scan"], [1, 2, 1, "", "get_oemconfig_oem_resize"], [1, 2, 1, "", "get_oemconfig_oem_systemsize"], [1, 2, 1, "", "get_oemconfig_swap_mbytes"], [1, 2, 1, "", "get_oemconfig_swap_name"], [1, 2, 1, "", "get_package_manager"], [1, 2, 1, "", "get_package_sections"], [1, 2, 1, "", "get_packages_sections"], [1, 2, 1, "", "get_partitions"], [1, 2, 1, "", "get_preferences_sections"], [1, 2, 1, "", "get_products"], [1, 2, 1, "", "get_release_version"], [1, 2, 1, "", "get_repositories_signing_keys"], [1, 2, 1, "", "get_repository_sections"], [1, 2, 1, "", "get_repository_sections_used_for_build"], [1, 2, 1, "", "get_repository_sections_used_in_image"], [1, 2, 1, "", "get_root_filesystem_uuid"], [1, 2, 1, "", "get_root_partition_uuid"], [1, 2, 1, "", "get_rpm_check_signatures"], [1, 2, 1, "", "get_rpm_excludedocs"], [1, 2, 1, "", "get_rpm_locale"], [1, 2, 1, "", "get_rpm_locale_filtering"], [1, 2, 1, "", "get_strip_files_to_delete"], [1, 2, 1, "", "get_strip_libraries_to_keep"], [1, 2, 1, "", "get_strip_list"], [1, 2, 1, "", "get_strip_tools_to_keep"], [1, 2, 1, "", "get_system_archives"], [1, 2, 1, "", "get_system_archives_target_dirs"], [1, 2, 1, "", "get_system_collection_type"], [1, 2, 1, "", "get_system_collections"], [1, 2, 1, "", "get_system_files"], [1, 2, 1, "", "get_system_ignore_packages"], [1, 2, 1, "", "get_system_packages"], [1, 2, 1, "", "get_system_products"], [1, 2, 1, "", "get_to_become_deleted_packages"], [1, 2, 1, "", "get_user_groups"], [1, 2, 1, "", "get_users"], [1, 2, 1, "", "get_users_sections"], [1, 2, 1, "", "get_vagrant_config_virtualbox_guest_additions"], [1, 2, 1, "", "get_volume_group_name"], [1, 2, 1, "", "get_volume_management"], [1, 2, 1, "", "get_volumes"], [1, 2, 1, "", "is_xen_guest"], [1, 2, 1, "", "is_xen_server"], [1, 2, 1, "", "package_matches_host_architecture"], [1, 2, 1, "", "preferences_matches_host_architecture"], [1, 2, 1, "", "profile_matches_host_architecture"], [1, 2, 1, "", "repository_matches_host_architecture"], [1, 2, 1, "", "resolve_this_path"], [1, 2, 1, "", "set_container_config_tag"], [1, 2, 1, "", "set_derived_from_image_uri"], [1, 2, 1, "", "set_repository"], [1, 2, 1, "", "set_root_filesystem_uuid"], [1, 2, 1, "", "set_root_partition_uuid"], [1, 2, 1, "", "volume_matches_host_architecture"]], "kiwi.xml_state.description_type": [[1, 3, 1, "", "author"], [1, 3, 1, "", "contact"], [1, 3, 1, "", "specification"]], "kiwi.xml_state.package_type": [[1, 3, 1, "", "package_section"], [1, 3, 1, "", "packages_section"]], "kiwi.xml_state.size_type": [[1, 3, 1, "", "additive"], [1, 3, 1, "", "mbytes"]], "kiwi.xml_state.volume_type": [[1, 3, 1, "", "attributes"], [1, 3, 1, "", "fullsize"], [1, 3, 1, "", "is_root_volume"], [1, 3, 1, "", "label"], [1, 3, 1, "", "mountpoint"], [1, 3, 1, "", "name"], [1, 3, 1, "", "parent"], [1, 3, 1, "", "realpath"], [1, 3, 1, "", "size"]]}, "objnames": {"0": ["py", "module", "Python module"], "1": ["py", "class", "Python class"], "2": ["py", "method", "Python method"], "3": ["py", "attribute", "Python attribute"], "4": ["py", "function", "Python function"], "5": ["py", "exception", "Python exception"]}, "objtypes": {"0": "py:module", "1": "py:class", "2": "py:method", "3": "py:attribute", "4": "py:function", "5": "py:exception"}, "terms": {"": [1, 4, 7, 18, 20, 21, 22, 23, 26, 28, 29, 30, 33, 36, 45, 46, 47, 49, 51, 52, 53, 54, 56, 57, 60, 61, 63, 67, 68, 72, 74, 77, 78, 79, 80, 82, 83, 84, 87, 92, 96, 98], "0": [1, 4, 6, 10, 12, 14, 15, 20, 23, 29, 32, 33, 34, 38, 47, 48, 49, 53, 55, 57, 58, 60, 68, 74, 75, 77, 78, 79, 80, 83, 85, 86, 87, 89, 94, 95, 96], "00": 93, "04": [54, 72], "08": 68, "0x0": 60, "0x1b8": 23, "0xfe": 23, "0xff": 60, "1": [1, 4, 6, 10, 20, 23, 25, 26, 28, 29, 30, 31, 32, 33, 45, 49, 51, 53, 54, 57, 60, 61, 68, 69, 72, 73, 74, 77, 78, 79, 80, 83, 84, 85, 86, 87, 89, 90, 91, 93, 94, 95, 96, 98], "10": [0, 34, 35, 38, 45, 54, 55, 57, 59, 60, 62, 64, 65, 66, 68, 69, 77, 80, 93], "100": [14, 30, 55, 72, 80, 82, 93], "1003746": 33, "100g": 80, "1024": 85, "10240": [86, 87], "10g": [86, 87], "10sec": [1, 93], "11": [54, 93], "119cwxvdxfuvyeinjh77unzrnahj": 67, "12": [34, 51], "1275903": 80, "1275904": 80, "128": [15, 60], "1296383": 80, "1296384": 80, "1316863": 80, "1316864": 80, "1337343": 80, "1337344": 80, "14dtqba5f1mgcvf": 67, "15": [28, 30, 31, 32, 33, 38, 48, 61, 67, 68, 69, 77, 78, 83, 84, 90, 91, 93, 94, 95], "15gb": 64, "16": [30, 54, 72], "168": [30, 93], "192": [30, 93], "19699": 51, "1g": 83, "1sec": 84, "2": [0, 1, 4, 6, 20, 22, 23, 25, 33, 35, 45, 54, 55, 57, 59, 60, 62, 64, 65, 66, 69, 74, 77, 80, 93, 96], "20": [33, 38, 60, 80], "200": 60, "2003": 34, "200m": 60, "2019": 54, "2021": [54, 68], "20211008": 68, "2048": [15, 30, 80], "2048000": 84, "20g": [30, 37, 72], "20mb": 60, "21": 29, "22": [29, 72], "23": [54, 60], "234": 60, "25519": 54, "26": 54, "28": 63, "2g": 83, "3": [1, 4, 20, 23, 28, 30, 31, 32, 33, 38, 54, 55, 60, 61, 63, 64, 68, 69, 72, 74, 77, 79, 80, 84, 90, 91, 93, 94, 95], "30": [29, 38, 46], "300": [80, 85], "30720": 85, "30g": 85, "32": 60, "32bit": 1, "32g": 72, "38400n8": 87, "3864575": 80, "3864576": 80, "39": 60, "3xzteojzch2qczjega5zsp9lxi": 67, "4": [1, 20, 23, 33, 51, 54, 60, 74, 77, 79, 80], "40": [1, 38], "4096": [30, 32, 33, 54, 69, 93], "42": [10, 33, 89], "45": 14, "47103": 80, "47104": 80, "480g": 46, "4g": [29, 83], "4k": 93, "4k9c7pjlg1adh8sf": 67, "5": [1, 20, 23, 28, 30, 32, 33, 38, 49, 54, 60, 64, 67, 68, 69, 78, 80, 93], "50": [38, 46, 54, 60], "500g": 46, "500m": 83, "500mb": 46, "512": [1, 30, 33, 60], "5mb": 93, "6": [1, 23, 80], "6143": 80, "6144": 80, "6287326": 80, "64": 33, "64_efi": 96, "64bit": [1, 47], "65535": 1, "661503": 80, "661504": 80, "7": [1, 2, 23, 46, 79, 80], "700m": 1, "73": 93, "75": 54, "8": [1, 23, 29, 32, 33, 47, 48, 49, 53, 60, 67, 68, 77, 78, 80, 83, 89], "80": 10, "8300": 80, "9": [28, 54, 80], "90": 46, "90my": 46, "99": [55, 60, 68], "9_": 60, "9p": [67, 72], "9pf": 67, "A": [1, 11, 21, 22, 23, 24, 25, 31, 32, 33, 38, 39, 41, 43, 46, 47, 48, 49, 50, 51, 52, 53, 54, 60, 61, 64, 65, 68, 77, 79, 80, 82, 85, 86, 87, 88, 89, 93, 94, 95], "And": [47, 62, 68], "As": [23, 29, 45, 46, 49, 51, 56, 57, 60, 61, 67, 68, 71, 77, 80, 90, 91, 93, 98], "At": [45, 46, 57, 60, 62, 64, 74], "Be": 92, "But": 30, "By": [1, 20, 21, 25, 30, 31, 38, 45, 46, 49, 51, 60, 61, 77, 80, 82, 93], "For": [4, 6, 7, 13, 20, 25, 29, 30, 31, 32, 33, 34, 36, 37, 41, 43, 45, 46, 47, 48, 51, 52, 54, 56, 57, 58, 60, 61, 63, 65, 67, 68, 72, 73, 74, 75, 77, 78, 79, 80, 82, 83, 85, 86, 87, 89, 91, 92, 93, 94, 95], "If": [1, 6, 12, 16, 19, 20, 21, 22, 23, 24, 25, 26, 30, 32, 34, 36, 37, 38, 39, 41, 43, 45, 46, 47, 49, 50, 51, 54, 57, 58, 60, 61, 62, 63, 65, 67, 68, 69, 71, 72, 77, 79, 80, 81, 82, 83, 84, 89, 93, 94, 96], "In": [1, 6, 11, 12, 13, 14, 16, 20, 21, 23, 26, 30, 31, 32, 34, 41, 42, 43, 46, 47, 48, 51, 52, 54, 57, 60, 61, 62, 63, 64, 65, 67, 69, 72, 73, 74, 75, 77, 79, 80, 81, 82, 83, 84, 88, 89, 90, 91, 92, 93, 94, 95, 96], "It": [1, 12, 21, 23, 28, 29, 30, 32, 33, 34, 38, 39, 41, 43, 45, 46, 48, 49, 51, 52, 53, 54, 55, 56, 58, 60, 61, 64, 65, 74, 75, 77, 78, 80, 87, 92, 93, 98], "NOT": 51, "No": 67, "Not": [6, 60, 93, 94, 95], "Of": 84, "On": [23, 30, 51, 54, 56, 60, 75, 81, 93, 94, 95, 96], "One": [60, 71, 83], "Or": [54, 69, 77], "Such": [60, 73, 88, 93], "That": [1, 23, 60, 68, 77, 96], "The": [1, 2, 4, 6, 9, 11, 12, 13, 14, 16, 18, 19, 20, 21, 22, 23, 24, 25, 26, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 41, 42, 43, 44, 46, 48, 49, 51, 52, 53, 55, 56, 58, 59, 60, 61, 63, 64, 65, 67, 68, 69, 70, 71, 72, 73, 75, 77, 78, 79, 80, 81, 82, 83, 84, 88, 89, 90, 91, 92, 93, 94, 95, 96, 98], "Their": 62, "Then": [28, 58], "There": [1, 6, 12, 14, 23, 26, 47, 51, 52, 59, 60, 63, 73, 74, 75, 77, 79, 80, 82, 84, 96], "These": [1, 22, 23, 33, 47, 51, 52, 54, 56, 58, 63, 64, 65, 77], "To": [29, 30, 31, 32, 33, 45, 46, 51, 54, 58, 60, 61, 63, 64, 67, 68, 71, 72, 74, 75, 76, 78, 79, 82, 85, 86, 87, 89, 93, 94, 96, 97], "With": [29, 31, 32, 46, 52, 58, 60, 62, 67, 71, 80, 90, 92, 93, 96], "_": [39, 41, 56, 61], "__init__": 54, "_cmdline": 6, "_config": 41, "_create_embedded_fat_efi_imag": 13, "_kernel_module_list_": 46, "_multibuild": [77, 78], "_non_": 23, "_per_test": 58, "_tools_my_module_script_needs_": 46, "aaaaaaaaaaaaaaaaaaaaaabbbbbbbbbbbbbbbbbb": 54, "aaaab3nzac1yc2eaaaadaqabaaabgqctiqdaygemkr7za7qc4ipxftgu": 67, "aabbccddeeff0011": 54, "aarch64": 71, "ab": 93, "abc": 6, "abil": [62, 91, 92], "abl": [15, 23, 51, 52, 60, 71, 74, 75, 85, 86, 87, 91, 92, 96, 97], "abort": [45, 51], "about": [1, 13, 21, 26, 36, 38, 41, 43, 45, 54, 56, 57, 59, 60, 61, 64, 65, 74, 79, 80, 81, 82, 90, 91, 93, 96, 98], "abov": [21, 30, 34, 38, 46, 48, 49, 51, 54, 57, 58, 59, 60, 61, 67, 71, 72, 77, 80, 82, 84, 85, 86, 87, 89, 92, 93, 94, 95], "absolut": [1, 49, 60], "abstract": [6, 45, 51, 54, 55, 57, 64, 65, 67, 68, 69, 70, 72, 74, 75, 77], "accept": [32, 49, 79], "access": [1, 20, 24, 29, 51, 53, 60, 62, 75, 77, 88, 91, 92, 93, 94, 95], "access_mod": 1, "accident": 45, "accommod": 60, "accomplish": 45, "accord": [1, 6, 16, 20, 23, 26, 30, 34, 44, 47, 56, 60, 82, 93], "accordingli": 93, "account": [1, 7, 16, 21, 34, 46, 47, 53, 60, 62, 64, 68], "accumulate_fil": 23, "accumulate_mbyte_file_s": 23, "accur": [14, 60], "achiev": [78, 89], "acknowledg": 30, "across": [61, 67], "act": [43, 47, 64, 78], "action": [1, 6, 30, 51, 60, 75, 95], "activ": [1, 16, 20, 23, 26, 30, 32, 46, 51, 54, 60, 61, 62, 64, 84, 86, 87, 90, 91, 93, 97], "activate_boot_partit": 20, "actual": [1, 4, 21, 22, 23, 49, 52, 61, 63, 68, 69, 80, 81, 83], "ad": [4, 13, 23, 30, 45, 51, 54, 57, 60, 67, 68, 77, 78, 81, 82, 83, 89, 92], "adapt": [23, 60, 77, 96], "add": [1, 4, 6, 13, 16, 18, 22, 23, 24, 25, 28, 29, 30, 31, 32, 33, 34, 36, 41, 43, 44, 45, 46, 47, 49, 51, 54, 55, 57, 60, 63, 65, 67, 68, 76, 77, 78, 79, 82, 85, 86, 87, 88, 89, 92, 97], "add_bundle_format": 23, "add_container_config_label": 1, "add_dracutmodul": [46, 95], "add_efi_loader_paramet": 13, "add_repo": 16, "add_repositori": [1, 18, 55], "addit": [1, 15, 16, 21, 22, 23, 28, 29, 30, 31, 32, 33, 34, 37, 38, 45, 46, 47, 48, 50, 51, 52, 57, 60, 61, 62, 64, 65, 68, 77, 78, 79, 80, 81, 82, 83, 89, 91, 92, 93], "addition": [45, 48, 53, 60, 83, 89], "additional_nam": 10, "addrepo": [28, 34, 63], "address": [6, 13, 21, 22, 33, 54, 63, 67, 68, 93, 95, 96], "adher": [50, 54], "adjust": [60, 77, 93], "adm": 97, "administr": [62, 94], "advanc": 89, "advis": [37, 48, 53, 74], "ae": 60, "aead": 60, "af_vsock": 29, "affect": [42, 60], "afford": 75, "after": [4, 6, 12, 14, 16, 26, 29, 30, 36, 42, 45, 46, 47, 51, 54, 60, 61, 62, 65, 78, 80, 81, 84, 94, 95, 98], "afterward": [51, 81], "again": [12, 45], "against": [1, 34, 51, 61, 65, 75], "agent": 85, "algorithm": 60, "alia": [1, 4, 20, 23, 36, 41, 43, 49, 60, 68, 98], "alias": 41, "all": [1, 6, 12, 16, 20, 23, 24, 26, 27, 28, 30, 31, 33, 34, 36, 38, 39, 41, 43, 45, 46, 47, 49, 50, 51, 52, 54, 58, 59, 60, 61, 65, 67, 68, 71, 73, 75, 77, 79, 80, 81, 83, 84, 86, 90, 91, 92, 93, 94, 95, 96, 98], "all_volum": 26, "allow": [1, 4, 11, 12, 16, 18, 23, 24, 30, 32, 34, 37, 38, 41, 43, 45, 46, 47, 49, 52, 54, 56, 57, 59, 60, 61, 62, 65, 67, 68, 75, 77, 79, 80, 81, 82, 83, 84, 85, 86, 87, 89, 91, 92, 93, 96], "allow_exist": 23, "allow_plymouth": 46, "almost": [1, 92], "alon": 51, "along": [1, 6, 30, 34, 46, 49, 60], "alongsid": [46, 54, 89], "alpha": 96, "alphanumer": 34, "alreadi": [1, 2, 16, 21, 25, 41, 43, 45, 46, 47, 51, 60, 65, 68, 82, 96], "also": [1, 4, 11, 12, 14, 21, 23, 24, 25, 26, 30, 31, 33, 36, 38, 39, 44, 45, 46, 47, 49, 51, 52, 54, 55, 58, 60, 61, 62, 63, 64, 67, 68, 71, 73, 77, 80, 81, 82, 83, 84, 87, 88, 89, 90, 91, 92, 93, 98], "altern": [13, 20, 38, 60, 64, 71, 79, 81, 82, 88, 89, 95, 98], "alternative_lookup_path": 1, "although": [38, 46, 77], "alwai": [1, 7, 20, 23, 30, 31, 60, 74, 77, 80, 82], "amazon": [1, 29, 33, 60, 61, 76], "among": [11, 65, 77, 80], "amount": [30, 60], "an": [1, 2, 4, 6, 9, 11, 12, 13, 14, 16, 20, 21, 23, 26, 27, 28, 31, 33, 34, 36, 38, 39, 40, 41, 42, 43, 45, 46, 47, 49, 50, 51, 52, 54, 55, 56, 57, 59, 60, 61, 62, 63, 64, 67, 68, 69, 71, 72, 73, 74, 75, 76, 77, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 91, 92, 93, 94, 95, 96, 98], "ani": [1, 4, 11, 13, 14, 15, 16, 20, 21, 22, 23, 26, 30, 31, 41, 42, 43, 45, 46, 47, 48, 49, 51, 52, 54, 57, 58, 59, 60, 61, 63, 64, 65, 67, 68, 69, 71, 73, 78, 80, 81, 82, 84, 88, 93, 94, 95], "annoi": 73, "annot": 60, "anoth": [1, 33, 48, 52, 60, 64, 68, 69, 79, 80, 93], "anymarkup": [1, 36, 52], "anymor": 80, "anyon": [53, 62], "anyth": [1, 23], "anywai": [54, 63], "aoe": [32, 93, 94, 95], "aoeinterfac": [94, 95], "aoeroot": 93, "apart": 63, "api": [1, 13, 54, 60, 62], "api_url": 1, "apparmor": 75, "appear": [33, 38, 49, 60, 77, 80, 82, 94, 95], "append": [1, 2, 9, 21, 23, 25, 30, 31, 39, 53, 60, 61, 81, 93, 94, 95], "append_fil": 2, "append_unpartitioned_spac": 9, "appidentif": 34, "appli": [1, 6, 23, 31, 32, 41, 43, 45, 46, 47, 48, 49, 51, 54, 55, 57, 60, 61, 65, 69, 75, 78, 80, 81, 83, 89, 93], "applianc": [4, 28, 29, 30, 31, 32, 33, 34, 38, 45, 46, 47, 48, 49, 51, 54, 60, 61, 64, 67, 69, 75, 76, 77, 79, 84, 93], "applic": [1, 33, 51, 54, 58, 60, 62, 64, 75, 79, 80, 84], "application_id": [34, 60], "apply_attributes_on_volum": 26, "appreci": 54, "approach": [46, 63, 82, 84, 93], "appropri": [9, 22, 23, 29, 31, 32, 33, 45, 54, 60, 61, 63, 77], "appx": [9, 34, 52, 60, 61], "appxmanifest": 34, "apschedul": 1, "apt": [41, 43, 45, 60, 67, 73, 79], "ar": [1, 6, 7, 9, 11, 15, 16, 21, 23, 25, 26, 28, 29, 30, 31, 32, 33, 34, 36, 38, 39, 41, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 57, 58, 59, 60, 61, 62, 63, 64, 65, 67, 68, 69, 70, 71, 73, 74, 75, 77, 79, 80, 81, 82, 83, 84, 89, 90, 91, 92, 93, 94, 95, 96, 98], "arbitrari": [21, 45, 54, 65], "arc_x86": 96, "arch": [1, 18, 21, 29, 33, 38, 47, 60, 61, 67, 68, 71, 77, 79, 83], "architectur": [1, 7, 16, 20, 23, 33, 34, 38, 39, 45, 47, 52, 54, 60, 61, 67, 70, 77, 79, 83], "archiv": [0, 1, 4, 10, 21, 23, 30, 33, 39, 45, 46, 52, 59, 61, 65, 77, 79, 89], "archive_tool": 1, "archivebuild": 9, "archivecpio": 2, "archivetar": 2, "archlinux": 62, "area": [1, 9, 46, 60, 74, 82], "aren": 72, "arg": [1, 16, 21, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 51], "argument": [1, 6, 7, 9, 10, 11, 12, 14, 16, 21, 23, 24, 26, 60], "arm": [60, 62, 71], "armi": 62, "around": [13, 54], "arrai": [1, 20, 93], "articl": [33, 68, 75, 84, 85, 86, 87, 88, 89, 90, 91, 92, 94, 95], "artifact": [23, 61], "artifici": 1, "ask": [1, 20, 60, 67, 84], "aspect": [68, 73], "assert": 58, "assign": [1, 23, 47, 53, 60, 80, 90, 91, 93], "associ": [1, 31, 33, 41, 51, 60, 61, 67], "assum": [1, 23, 56, 65, 72, 89, 91, 93, 94, 95], "assumpt": 31, "asterix": 51, "ata": [32, 93, 94, 95], "atftp": 93, "attach": [30, 51, 57, 69, 84], "attempt": [1, 41], "attent": 33, "attlist": 57, "attr": [41, 43, 54], "attr_token": 24, "attribut": [1, 4, 6, 11, 16, 20, 23, 24, 25, 28, 29, 30, 31, 32, 33, 36, 39, 41, 43, 46, 47, 48, 49, 51, 53, 54, 57, 60, 61, 64, 79, 80, 82, 83, 84, 88, 89], "attribute_list": 60, "attribute_nam": 1, "audienc": 62, "authent": 19, "authkei": 86, "author": [1, 10, 28, 34, 59, 60, 68, 79], "authorized_kei": 67, "auto": [1, 32, 54, 63], "auto_contain": 58, "auto_container_per_test": 58, "autodetect": 25, "autof": 81, "autogener": 1, "autom": [64, 65, 77], "automat": [1, 21, 30, 32, 34, 46, 51, 54, 60, 65, 77, 80, 89], "automount": 81, "autoyast": 97, "avail": [1, 4, 19, 20, 30, 33, 36, 38, 41, 46, 47, 49, 51, 52, 54, 55, 58, 60, 63, 65, 67, 69, 73, 77, 80, 84, 93, 94, 96], "avoid": [1, 20, 45, 46, 51, 54, 60, 81, 82, 96], "aw": [27, 61, 86], "azur": [33, 60, 61, 76], "azurectl": 85, "b": [23, 24, 54, 79, 80], "back": [1, 25], "backend": [1, 60, 95], "background": 79, "backtrac": 1, "backward": 54, "bar": 1, "bar_length": 1, "bar_profil": 77, "base": [1, 2, 8, 9, 10, 17, 18, 20, 22, 23, 25, 28, 30, 32, 34, 37, 38, 41, 43, 45, 46, 47, 51, 52, 54, 56, 60, 61, 62, 63, 64, 66, 67, 71, 77, 79, 80, 82, 88, 89, 93, 94, 95], "base_imag": 10, "baseinsertservic": 51, "basenam": [1, 4, 24, 38], "basename_of_integrity_keyfile_without_file_extens": 60, "baseproduct": 51, "baseremoveservic": 51, "baseservic": 51, "basesetrunlevel": 51, "basestrip": 51, "basestripandkeep": 51, "basestriplocal": 51, "basestriptransl": 51, "basestripunusedlib": 51, "basesystem": 98, "basesystemdcal": 51, "basesystemdserviceinstal": 51, "basesysvserviceinstal": 51, "baseupdatesysconfig": 51, "baseurl": [16, 60], "basevagrantsetup": [51, 89], "bash": [1, 10, 23, 28, 29, 43, 46, 51, 65, 77, 86, 93], "basic": [1, 18, 28, 30, 36, 46, 64], "bc": 96, "bc_efi": 96, "bear": 77, "becam": 23, "becaus": [1, 6, 21, 28, 30, 31, 34, 41, 46, 51, 52, 58, 60, 62, 67, 80, 81, 82, 84, 90, 92, 98], "becom": [1, 13, 23, 24, 60, 67, 81, 83, 88, 90, 92], "beef": 22, "been": [14, 15, 21, 30, 45, 51, 60, 65, 93, 94, 95, 98], "befor": [1, 12, 20, 23, 30, 34, 41, 42, 43, 45, 46, 47, 51, 54, 60, 61, 63, 77, 78, 87, 93, 95], "beforehand": [54, 60, 93], "begin": [36, 45, 51, 60, 65, 79], "behav": [25, 36], "behavior": [1, 21, 46, 47, 60, 64, 65], "behaviour": [1, 23, 93], "being": [23, 32, 47, 60], "bellow": 77, "belong": [1, 47, 48, 49, 50, 52, 54, 60], "below": [1, 25, 26, 29, 30, 31, 32, 33, 41, 43, 46, 51, 52, 56, 57, 60, 69, 71, 98], "berlin": 60, "besid": [45, 62], "best": [70, 74, 77, 98], "better": [23, 54, 60, 77], "between": [1, 6, 16, 23, 38, 41, 43, 49, 60, 67, 71, 74, 80], "beyond": [38, 55], "bgrt": 60, "big": [1, 46, 84], "bigger": 54, "billing_cod": 21, "bin": [10, 28, 29, 46, 47, 51, 58, 83, 86], "bin_volum": 83, "binari": [1, 13, 28, 29, 34, 38, 47, 60, 61], "binarynam": 1, "bind": [1, 23, 38, 51], "bind_loc": 23, "bind_mount": 1, "binutil": 71, "bio": [1, 9, 20, 46, 52, 60, 90, 91, 93], "bios_grub": 1, "bios_mod": 1, "bit": [1, 33, 51, 54, 60, 65, 72], "bl": [1, 7, 60], "blkid": [20, 25], "blob": 60, "block": [1, 12, 20, 26, 46, 60, 80, 93, 94, 95], "blockdev": [20, 60], "blockid": 25, "blocksiz": [20, 60, 93], "blocksize_byt": 20, "blscfg": 60, "bold": 1, "bool": [1, 2, 4, 6, 7, 8, 10, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 54], "boolean": [1, 14, 33, 48, 49, 60, 83], "boostrap": 79, "boot": [0, 1, 6, 7, 9, 11, 13, 20, 23, 26, 30, 31, 32, 33, 37, 38, 42, 45, 51, 52, 60, 61, 62, 65, 67, 68, 69, 70, 73, 74, 76, 80, 81, 82, 84, 85, 86, 87, 88, 89, 90, 91], "boot_clon": [20, 60, 80], "boot_devic": [6, 7], "boot_device_nod": 23, "boot_dir": 6, "boot_directory_nam": 60, "boot_image_task": 9, "boot_names_typ": 4, "boot_opt": [6, 60], "boot_part_id": 23, "boot_partition_s": 20, "boot_path": 6, "boot_server_ip": 96, "boot_them": 13, "boot_timeout": 60, "boot_timeout_styl": 60, "boot_uuid": 6, "bootabl": [1, 9, 52, 60, 84, 90, 91], "bootcmd": 86, "bootctl": [6, 60], "bootdelet": 1, "bootfilesystem": [60, 80], "bootimag": [4, 9], "bootimagebas": [4, 9], "bootimagedracut": 4, "bootimagekiwi": 4, "bootimg": 4, "bootinclud": [1, 4], "bootload": [0, 1, 11, 13, 32, 51, 52, 68, 75, 80, 84, 85, 86, 87, 88, 89, 91, 93], "bootloaderconfigbas": 6, "bootloaderconfiggrub2": 6, "bootloaderinstal": 7, "bootloaderinstallbas": 7, "bootloaderinstallgrub2": 7, "bootloaderinstallsystemdboot": 7, "bootloaderinstallzipl": 7, "bootloaderset": 1, "bootloaderspecbas": 6, "bootloadersystemdboot": 6, "bootloadertemplategrub2": 8, "bootloaderzipl": 6, "bootopt": 30, "bootparam": 46, "bootpartit": [20, 60, 80, 85, 88], "bootparts": [60, 85], "bootpath": 60, "bootstrap": [1, 14, 16, 23, 41, 43, 45, 47, 51, 60, 76], "bootstrap_packag": [1, 14, 60], "bootup": 46, "bootwait": 30, "both": [1, 13, 32, 38, 45, 47, 51, 60, 61], "bottom": [45, 47, 77], "bound": 54, "box": [1, 21, 22, 51, 60, 62, 67, 71, 73, 74, 77, 89], "boxbuild": [70, 75], "bracket": [41, 43], "brand": 51, "break": [23, 30, 47, 51, 54, 77], "bridg": [30, 33, 93, 94], "brief": 77, "broken": [1, 71, 80, 89, 96], "brows": 98, "browser": 63, "bsize": 93, "btrf": [1, 6, 9, 60, 61, 82, 83], "btrfs_default_volume_request": 1, "btrfs_quota_group": 60, "btrfs_root_is_readonly_snapshot": 60, "btrfs_root_is_snapshot": 60, "btrfs_root_is_subvolum": 60, "btrfs_set_default_volum": 60, "bug": 54, "build": [1, 4, 6, 9, 12, 14, 16, 20, 21, 22, 23, 24, 25, 35, 36, 37, 38, 39, 40, 42, 43, 46, 47, 48, 49, 51, 54, 55, 59, 60, 61, 63, 64, 65, 66, 70, 71, 74, 75, 76, 79, 80, 81, 82, 84, 85, 86, 87, 88, 89, 90, 91, 92, 94, 95], "build_constraint": 1, "build_flavor": [77, 78], "build_result": 61, "build_service_tutori": 77, "build_typ": [1, 38, 55], "buildah": 1, "buildbox": 72, "buildenv": 1, "builder": [0, 1, 49, 54, 60, 62, 63, 64, 69, 75, 77, 93], "buildservic": [1, 23, 41, 77], "buildsystem": [1, 23, 28], "built": [1, 6, 30, 54, 58, 67, 68, 69, 77, 82, 84, 85, 86, 87, 89, 90, 91, 92, 93, 94, 95], "builtin": 46, "bumpvers": 54, "bundl": [1, 23, 24, 35, 72], "bundle_format": [1, 39, 61], "bundle_id": 39, "bundler": [24, 61], "busi": [1, 98], "buslog": 33, "by6jar3ajfkvrpshrzrqj6cwyu3bfmolupcpqok2xfyou2lepazdejgpsjq": 67, "bypass": [1, 46], "byte": [1, 20, 21, 23, 37, 60, 80, 82], "bytes": 1, "c": [1, 24, 29, 69, 92, 96], "c8": 93, "ca": [47, 60, 86], "cach": [1, 16, 23, 38, 41, 43], "calcul": [1, 12, 23, 30, 60, 82, 84], "calculate_id": 23, "call": [1, 4, 6, 14, 16, 17, 18, 20, 23, 26, 28, 31, 33, 38, 45, 46, 49, 50, 51, 52, 54, 56, 57, 59, 60, 61, 62, 64, 65, 67, 68, 74, 78, 81, 84, 89, 91, 92, 93, 96], "call_config_host_overlay_script": 23, "call_config_overlay_script": 23, "call_config_script": 23, "call_disk_script": 23, "call_edit_boot_config_script": 23, "call_edit_boot_install_script": 23, "call_image_script": 23, "call_post_bootstrap_script": 23, "call_pre_disk_script": 23, "callabl": 1, "caller": [1, 4, 13, 16, 22, 68], "can": [1, 6, 7, 12, 13, 21, 22, 23, 24, 25, 26, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 67, 68, 69, 71, 72, 73, 74, 75, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 98], "candid": 70, "cannot": [1, 32, 45, 47, 49, 51, 60, 61, 68, 77, 82, 89, 93], "canonical_volume_typ": 26, "capabi": 60, "capabl": [1, 13, 20, 30, 47, 60, 67, 71, 80], "capit": 54, "card": [59, 62], "care": [6, 11, 14, 21, 67, 80, 81], "carri": [22, 82, 89], "case": [1, 4, 6, 11, 12, 14, 21, 23, 25, 26, 30, 31, 32, 41, 43, 46, 47, 49, 51, 52, 54, 55, 58, 59, 60, 61, 63, 64, 67, 68, 69, 73, 81, 82, 83, 84, 88, 89, 93, 94, 95], "cat": 31, "categori": [1, 52], "caus": [1, 6, 41, 47, 60, 69, 74, 75, 80], "caution": [41, 47], "cc": 47, "cd": [22, 32, 45, 47, 60, 61, 65, 90, 91, 92, 93, 95, 97], "cdl": 60, "cdrom": [30, 32, 84], "cdroot": [23, 45, 65], "cento": [18, 47, 60, 62], "cert": [60, 86], "certain": [23, 31, 47, 60, 64, 75, 80, 82, 89], "certif": [34, 47, 60], "cfg": [6, 30, 86, 92, 93, 94, 95, 96], "chain": [45, 52, 60, 74], "chanc": 60, "chang": [1, 12, 21, 23, 25, 26, 34, 45, 46, 51, 54, 60, 61, 67, 75, 77, 79, 81, 86, 87, 93, 96], "changelog": [1, 23], "channel": [1, 54], "chapter": [51, 60, 69, 75, 83], "charact": [6, 16, 23, 34, 38, 54, 60], "characterist": 81, "chardev": 29, "chattr": 1, "check": [1, 4, 6, 7, 11, 19, 20, 21, 23, 24, 25, 26, 28, 30, 32, 33, 34, 46, 47, 49, 51, 54, 63, 68, 72, 74, 80, 81, 83, 90, 91, 92, 93], "check_appx_naming_conventions_valid": 1, "check_boot_description_exist": 1, "check_build_environ": 23, "check_consistent_kernel_in_boot_and_system_imag": 1, "check_container_tool_chain_instal": 1, "check_dracut_module_for_disk_oem_in_package_list": 1, "check_dracut_module_for_disk_overlay_in_package_list": 1, "check_dracut_module_for_live_iso_in_package_list": 1, "check_dracut_module_for_oem_install_in_package_list": 1, "check_dracut_module_versions_compatible_to_kiwi": 1, "check_efi_fat_image_has_correct_s": 1, "check_efi_mode_for_disk_overlay_correctly_setup": 1, "check_for_root_permiss": 1, "check_image_include_repos_publicly_resolv": 1, "check_image_type_uniqu": 1, "check_image_version_provid": 1, "check_include_references_unresolv": 1, "check_initrd_selection_requir": 1, "check_luksformat_options_valid": 1, "check_mediacheck_instal": 1, "check_partuuid_persistency_type_used_with_mbr": 1, "check_repositories_configur": 1, "check_swap_name_used_with_lvm": 1, "check_target_directory_not_in_shared_cach": 1, "check_volume_label_used_with_lvm": 1, "check_volume_setup_defines_multiple_fullsize_volum": 1, "check_volume_setup_defines_reserved_label": 1, "check_volume_setup_has_no_root_definit": 1, "check_xen_uniquely_setup_as_server_or_guest": 1, "checkbox": 77, "checker": [1, 60], "checkiso": 8, "checkisomd5": 32, "checkmedia": [1, 32], "checkout": [54, 69, 77], "checksum": [1, 9, 13, 30, 32, 39], "checksum_filenam": 25, "child": [21, 28, 30, 33, 47, 48, 49, 53, 60, 77, 83], "children": [47, 51], "chip": 62, "chkstat": 23, "chmod": 60, "choic": [1, 60, 68, 77, 92], "choos": [32, 33, 54, 55, 77], "chosen": 77, "chown": 60, "chroot": [1, 4, 14, 17, 23, 24, 43, 45, 47, 51, 60, 79, 81], "ci": [54, 79], "cid": 29, "cipher": 60, "circumst": 60, "circumv": [60, 76], "clang": 47, "class": [1, 2, 4, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 54, 55, 56], "class_vers": 23, "classic": 62, "classifi": [1, 59, 94, 95], "classmethod": 54, "clean": [14, 23, 54, 73], "clean_leftov": 14, "clean_package_manager_leftov": 23, "cleanup": [4, 14, 16, 23, 98], "cleanup_fil": 23, "cleanup_request": 14, "cleanup_unused_repo": 16, "clear": [7, 23, 41, 43, 51, 53, 54, 73], "clear_cach": 23, "cleartext": 60, "cli": [63, 86], "click": [54, 63, 77], "client": [30, 62, 67, 79, 94, 95, 96], "clitask": [24, 56], "clone": [1, 20, 38, 60, 63, 64, 68, 69, 76, 82], "clonedevic": 20, "close": [51, 69], "cloud": [1, 33, 38, 60, 61, 62, 85, 86, 87], "cloud_config_modul": 86, "cloud_dir": 86, "cloud_final_modul": 86, "cloud_init_modul": 86, "cmd": 28, "cmdline": [6, 95], "code": [1, 7, 14, 21, 23, 37, 46, 47, 51, 56, 57, 60, 68, 80, 87, 92, 93], "collabor": 54, "collect": [1, 14, 18, 23, 31, 38, 45, 47, 51, 52, 54, 59, 60, 62, 63, 64, 65, 76, 89, 93], "collection_matches_host_architectur": 1, "collection_modul": 14, "collection_request": 14, "colon": [1, 60], "color": [1, 6, 24, 38], "colorformatt": 1, "colormessag": 1, "column": [54, 60], "com": [21, 29, 33, 34, 38, 54, 56, 57, 63, 68, 69, 79], "combin": [1, 24, 26, 30, 31, 32, 38, 41, 43, 46, 60, 89, 93, 95], "come": [58, 62, 68, 71, 79], "comma": [24, 30, 33, 48, 51, 53, 60, 83], "command": [2, 14, 24, 28, 30, 31, 33, 34, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 48, 50, 54, 56, 57, 60, 61, 62, 63, 68, 69, 72, 78, 82, 89, 90, 91, 94, 95, 96], "command_arg": 56, "command_env": [14, 16], "command_usag": 1, "commandcallt": [1, 14], "commandcap": 1, "commanditer": 1, "commandlin": [1, 6, 24, 29, 51, 60, 61, 93], "commandprocess": 1, "commandt": 1, "comment": [10, 50, 78], "commit": 54, "common": [24, 28, 34, 46, 51, 60, 75, 93], "commun": [62, 63, 74], "compar": [25, 30, 47, 60, 67, 73, 94, 95], "comparis": 23, "comparison": 2, "compat": [1, 16, 26, 31, 32, 49, 51, 54, 60, 73, 74, 94, 95], "compil": [47, 74], "complain": 60, "complet": [29, 32, 34, 45, 46, 47, 51, 54, 60, 64, 65, 84], "complex": [33, 54, 75, 80], "compli": [85, 86, 87], "compliant": [1, 52, 60, 68], "compon": [1, 9, 16, 31, 32, 33, 34, 38, 41, 43, 45, 49, 51, 52, 60, 61, 62, 67, 83], "compos": 65, "compress": [1, 2, 4, 9, 10, 21, 23, 24, 32, 33, 39, 45, 46, 51, 54, 57, 60, 77, 93], "compress_arch": 10, "compressed_filenam": 25, "compression_postfix": [45, 65], "compressor": 1, "compromis": 47, "comput": [1, 21, 29, 30, 33, 60, 61, 64, 76, 90, 92], "concaten": [39, 61], "concept": [1, 12, 26, 46, 56, 60, 64, 65, 75, 80], "concern": [31, 32, 63], "condit": [1, 58, 60, 82], "conditionfirstboot": [23, 51], "conditit": 20, "conf": [6, 46, 51, 60, 74, 93, 95, 96], "conf_fil": 4, "config": [0, 1, 4, 7, 13, 16, 20, 22, 23, 24, 28, 29, 30, 31, 32, 33, 34, 38, 43, 45, 47, 50, 54, 55, 57, 58, 60, 62, 63, 64, 65, 68, 75, 77, 78, 80, 83, 89, 93, 95, 96, 97], "config_fil": [4, 23], "configfil": 38, "configopt": 60, "configpars": 16, "configur": [1, 4, 6, 8, 11, 12, 14, 15, 16, 17, 20, 21, 22, 23, 24, 26, 28, 30, 32, 34, 36, 38, 41, 43, 45, 46, 47, 48, 49, 54, 58, 59, 60, 61, 62, 64, 65, 68, 74, 75, 82, 84, 86, 87, 89, 91, 92, 94, 95], "configuraton": 8, "confirm": 46, "conflict": [1, 20, 60, 70, 77, 80, 82, 87], "conftest": 58, "confus": 96, "conjunct": [54, 58], "connect": [22, 29, 30, 33, 41, 43, 47, 51, 58, 60, 67, 93, 94], "consequ": [60, 68, 77, 80], "consid": [1, 14, 23, 28, 47, 51, 54, 60, 67, 70, 80, 82, 83, 93], "consider": 30, "consist": [1, 9, 11, 12, 26, 31, 34, 38, 45, 51, 52, 54, 60, 61, 89, 93], "consol": [1, 11, 23, 29, 46, 60, 72, 85, 86, 87], "constant": [1, 54], "constraint": [1, 60, 64, 70, 71, 83, 85, 86, 87], "construct": [1, 6, 12, 60, 82], "constructor": [1, 20], "consult": [60, 78], "consum": [34, 54, 60, 68, 98], "contact": [1, 59, 60, 68, 69, 79], "contain": [0, 1, 4, 6, 7, 18, 20, 21, 23, 24, 25, 27, 30, 31, 36, 37, 38, 39, 40, 41, 43, 45, 46, 47, 48, 49, 50, 51, 52, 55, 58, 59, 61, 63, 64, 65, 66, 69, 73, 74, 75, 77, 80, 82, 89, 93], "container_fil": 1, "container_imag": 58, "container_matches_host_architectur": 1, "container_nam": 10, "container_per_test": 58, "container_runtim": 58, "container_tag": 10, "container_to_vm_lay": 68, "containerbuild": 9, "containerconfig": [1, 28, 34], "containerd": 28, "containerimag": 10, "containerimagebas": 10, "containerimageoci": 10, "containers_matches_host_architectur": 1, "containersetup": 11, "containersetupbas": 11, "containersetupdock": 11, "containersetupoci": 11, "containert": 1, "containig": 61, "content": [34, 38, 41, 43, 44, 51, 56, 60, 61, 63, 64, 68, 77, 78, 81, 82, 84, 93, 95, 96, 98], "context": [1, 23, 26, 34, 47], "continu": [6, 23, 30, 46, 51, 72], "contrari": 93, "contrast": [77, 89], "contribut": [62, 63], "control": [1, 4, 6, 11, 22, 39, 46, 47, 51, 60, 67, 73, 81, 89, 93], "conv": 30, "conv60_apirefer": 33, "conveni": 77, "convent": [1, 60, 61, 80], "convers": [1, 21, 36], "convert": [1, 21, 33, 36, 45, 57], "convet": 21, "cool": 57, "cop": 20, "cope": 60, "copi": [1, 4, 12, 23, 28, 30, 45, 46, 58, 60, 61, 63, 64, 65, 72, 77, 82, 83, 90, 91, 92, 93, 94, 95, 97], "copy_bootdelete_packag": 1, "copy_bootincluded_arch": 1, "copy_bootincluded_packag": 1, "copy_bootloader_sect": 1, "copy_build_type_attribut": 1, "copy_displaynam": 1, "copy_drivers_sect": 1, "copy_kernel": 23, "copy_machine_sect": 1, "copy_nam": 1, "copy_oemconfig_sect": 1, "copy_on_writ": 83, "copy_preferences_subsect": 1, "copy_repository_sect": 1, "copy_strip_sect": 1, "copy_systemdisk_sect": 1, "copy_xen_hypervisor": 23, "core": [1, 23, 52, 54, 71, 73, 96], "corespersocket": 33, "coreutil": 47, "corner": 54, "correct": [1, 6, 22, 30, 33, 46, 49, 57, 74, 84, 89, 93], "correctli": [6, 15, 42, 51, 60, 96], "correspond": [1, 6, 30, 60], "corrupt": 1, "could": [1, 11, 12, 20, 23, 36, 49, 60, 75, 77, 79, 93, 94], "couldn": 25, "count": [12, 33], "countdown": 60, "coupl": 60, "cover": [0, 6, 24, 28, 29, 30, 32, 33, 60, 62, 75, 93], "coverag": 54, "cow": [32, 46, 60], "cowf": [32, 46], "cowfil": [32, 46], "cp": [93, 94, 95, 97], "cpio": [9, 29, 46, 60, 77], "cpu": [22, 29, 33, 61, 72], "cpu_setup": 22, "cpuid": 33, "cracklib": 60, "crasgmgkim8apnk8rff": 67, "creat": [1, 2, 4, 6, 9, 10, 11, 12, 13, 15, 16, 19, 20, 21, 22, 23, 24, 25, 26, 28, 29, 30, 31, 32, 35, 38, 39, 40, 41, 43, 46, 47, 49, 51, 52, 55, 56, 57, 58, 59, 60, 61, 62, 64, 65, 67, 69, 71, 72, 73, 75, 77, 80, 81, 82, 83, 84, 86, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98], "create_boot_loader_config": 6, "create_boot_partit": 20, "create_box_img": 21, "create_crypto_luk": 20, "create_crypttab": 20, "create_custom_partit": 20, "create_degraded_raid": 20, "create_disk": 9, "create_disk_format": 9, "create_efi_csm_partit": 20, "create_efi_partit": 20, "create_efi_path": 6, "create_from_file_list": 2, "create_fstab": 23, "create_gnu_gzip_compress": 2, "create_hybrid_mbr": 20, "create_image_format": 21, "create_init_link_from_linuxrc": 23, "create_initrd": 4, "create_install_iso": 9, "create_install_media": 9, "create_install_pxe_arch": 9, "create_iso": 13, "create_loader_imag": 6, "create_match_method": 1, "create_mbr": 20, "create_on_devic": [12, 55], "create_on_fil": 12, "create_opt": 12, "create_prep_partit": 20, "create_raid_config": 20, "create_random_keyfil": 20, "create_recovery_arch": 23, "create_repository_solv": 19, "create_root_lvm_partit": 20, "create_root_partit": 20, "create_root_raid_partit": 20, "create_root_readonly_partit": 20, "create_spare_partit": 20, "create_swap_partit": 20, "create_verification_metadata": [12, 26], "create_verity_lay": [12, 26], "create_volum": 26, "create_volume_paths_in_root_dir": 26, "create_xz_compress": 2, "created_bi": [10, 34], "createimportspecparam": 33, "creation": [1, 2, 4, 6, 12, 13, 19, 20, 21, 23, 24, 25, 26, 32, 38, 45, 46, 51, 52, 54, 60, 62, 64, 65, 74, 76, 82], "creator": 60, "credenti": [1, 16, 20, 23, 41, 43, 60, 88], "credentials_fil": 16, "credentials_file_nam": 23, "criteria": [34, 62, 67], "critic": [38, 81, 88], "crl": 60, "cross": [38, 67, 71], "crt": 60, "crucial": 49, "cryptsetup": [1, 20, 60, 88], "crypttab": [20, 60], "csm": 60, "curl": [30, 93], "curl_opt": 30, "curli": [41, 43], "current": [1, 6, 7, 10, 15, 20, 21, 23, 26, 33, 47, 49, 54, 58, 60, 68, 77, 89, 94], "curv": 54, "custom": [1, 2, 4, 6, 7, 9, 10, 11, 12, 13, 14, 16, 20, 21, 23, 25, 26, 28, 29, 31, 45, 47, 49, 51, 54, 56, 60, 61, 62, 63, 64, 65, 76, 77, 81, 86], "custom_arg": [6, 7, 9, 10, 11, 12, 13, 14, 16, 21, 26], "custom_env": 1, "custom_filesystem_arg": 26, "custom_script": 60, "custom_set": [21, 22], "customiz": [60, 61], "customization_script": 16, "customizaton": 20, "cut": 29, "cv": 61, "d": [23, 24, 29, 30, 46, 51, 95], "daemon": [51, 67, 89], "dasd": [20, 60], "data": [1, 2, 4, 6, 9, 12, 13, 14, 16, 20, 21, 23, 25, 26, 29, 30, 32, 34, 38, 41, 43, 45, 46, 51, 57, 59, 60, 61, 62, 64, 65, 67, 68, 75, 80, 82, 88, 90, 91, 92, 93, 96], "data_blks": 60, "data_block": 60, "databas": [1, 14, 16, 41, 42, 43, 47, 61, 63, 75], "database_consist": 14, "datasource_list": 86, "datasync": 25, "date": [19, 54, 63, 93], "datefmt": 1, "dbu": [51, 79], "dd": [30, 90], "de": 41, "de_d": 60, "deactiv": [1, 11, 51, 60, 93], "deactivate_bootloader_setup": 11, "deactivate_root_filesystem_check": 11, "deactivate_systemd_servic": 11, "dead": 22, "deb": [41, 43, 49], "debconf": 79, "debian": [1, 41, 43, 60, 62, 76], "debug": [1, 24, 32, 38, 58, 60, 61, 72], "debugfilt": 1, "decentr": 62, "decid": [1, 20, 96], "decis": 77, "declar": [46, 48, 77], "declin": 67, "decod": 1, "decompress": [25, 77], "decor": 54, "decrypt": 60, "dedent": 22, "dedic": [31, 41, 43], "def": [54, 56, 58], "defacto": 68, "default": [6, 7, 12, 15, 16, 20, 21, 22, 23, 25, 26, 28, 29, 30, 31, 32, 33, 36, 38, 45, 46, 48, 49, 50, 51, 53, 54, 58, 60, 61, 62, 67, 68, 74, 77, 78, 80, 82, 83, 86, 89, 93, 94, 95, 96], "default_boot": 60, "default_us": 86, "defin": [1, 9, 10, 21, 28, 33, 41, 43, 45, 46, 47, 48, 49, 58, 59, 60, 61, 64, 72, 77, 82, 83, 89], "definit": [1, 4, 14, 23, 46, 55, 56, 60, 61, 83, 84, 85, 86, 87, 88, 98], "degrad": [20, 60], "delai": [30, 60], "delet": [1, 14, 16, 23, 24, 41, 43, 44, 45, 47, 51, 60, 68, 81, 92], "delete_all_repo": 16, "delete_packag": 23, "delete_repo": 16, "delete_repo_cach": 16, "delete_repository_sect": 1, "delete_repository_sections_used_for_build": 1, "delimit": [41, 43], "deliv": [34, 41, 90, 92], "delta": [1, 51], "delta_root": [14, 23, 51, 60], "demand": [36, 57, 60], "demo": [60, 61], "demonstr": [32, 55, 68], "depend": [1, 6, 14, 18, 19, 20, 21, 22, 23, 30, 32, 33, 36, 38, 41, 43, 45, 46, 47, 51, 52, 57, 60, 61, 63, 65, 67, 71, 72, 73, 74, 75, 77, 80, 81, 83, 93, 96, 98], "deploi": [30, 32, 46, 60, 62, 64, 65, 76, 81, 82, 93, 96], "deploy": [4, 31, 32, 38, 46, 51, 60, 61, 65, 80, 84, 91, 92], "derefer": 1, "deriv": [1, 41, 43], "derived_from": [1, 41, 43, 60], "descend": [59, 60], "describ": [18, 30, 31, 32, 33, 41, 45, 47, 51, 54, 55, 57, 59, 60, 63, 67, 69, 70, 72, 76, 77, 94, 96], "descript": [1, 4, 6, 22, 23, 24, 28, 29, 30, 31, 32, 33, 34, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 57, 61, 62, 64, 67, 68, 69, 72, 76, 77, 78, 79, 81, 82, 83, 93, 97, 98], "description_directori": 24, "description_typ": 1, "deserv": 33, "design": [30, 33, 36, 52, 60, 68, 73, 77, 82], "desir": [1, 23, 26, 28, 30, 34, 51, 60, 63, 69, 71], "despit": 82, "dest": 93, "dest_dir": 2, "destroi": [20, 80, 90, 91, 92], "detail": [1, 7, 13, 14, 23, 25, 29, 30, 31, 32, 33, 34, 36, 38, 41, 43, 45, 46, 47, 48, 51, 52, 56, 60, 61, 64, 65, 67, 68, 74, 78, 80, 82, 83, 89, 93, 94, 95], "detect": [1, 23, 25, 30, 32, 46, 60], "determin": [1, 23, 30, 33, 60], "dev": [11, 20, 46, 72, 84, 90, 91, 93, 94, 95], "devel": 54, "develop": [21, 31, 33, 56, 80, 89], "devic": [1, 6, 7, 11, 12, 15, 20, 23, 25, 26, 30, 32, 33, 46, 47, 52, 55, 60, 62, 67, 75, 80, 84, 90, 91, 92, 93, 94, 95], "device1": 93, "device2": 93, "device_map": 26, "device_nod": [12, 26], "device_provid": [7, 12, 23], "device_provider_root": 26, "devicepersist": [1, 30, 60, 85, 86], "deviceprovid": [7, 12, 15, 20, 23, 26], "dhcp": [79, 89, 93], "dialog": [46, 60], "dict": [1, 4, 6, 7, 9, 10, 11, 12, 13, 14, 16, 18, 20, 21, 23, 24, 26, 60], "dictionari": [1, 4, 6, 7, 12, 20, 21, 23, 24, 26, 60], "dictonari": 4, "did": [1, 60], "dif": 61, "differ": [1, 6, 14, 15, 21, 23, 25, 26, 30, 31, 32, 33, 36, 38, 45, 47, 48, 49, 51, 54, 57, 58, 60, 61, 63, 67, 68, 71, 73, 76, 80, 82, 85, 86, 87, 88, 89, 90, 91, 92], "differenti": 60, "difficult": [45, 58], "digit": [34, 60], "dir": [1, 4, 12, 20, 23, 28, 29, 30, 31, 32, 33, 34, 37, 38, 39, 40, 41, 42, 46, 49, 60, 61, 67, 68, 69, 72, 78, 93], "dir_path": 60, "dir_stack": 23, "direct": [1, 28, 49, 60, 96], "directli": [28, 45, 47, 51, 54, 60, 65, 68, 91, 92], "directori": [1, 2, 4, 6, 7, 9, 10, 11, 12, 14, 16, 20, 21, 23, 24, 25, 26, 28, 30, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 49, 51, 53, 54, 55, 56, 60, 62, 64, 65, 67, 68, 77, 89, 93, 96, 97, 98], "disabl": [1, 14, 24, 30, 33, 51, 60, 75, 80, 82, 84, 96], "disable_root": 86, "disadvantag": 77, "disambigu": 60, "disast": 80, "discov": 30, "discuss": 54, "disk": [1, 6, 7, 13, 21, 22, 23, 27, 32, 37, 38, 45, 46, 51, 52, 60, 61, 64, 67, 69, 72, 74, 76, 80, 84, 85, 86, 87, 89, 90, 91, 92], "disk_control": 22, "disk_imag": 9, "disk_image_capac": 22, "disk_provid": 15, "diskbuild": 9, "diskformat": 21, "diskformatbas": 21, "diskformatgc": 21, "diskformatova": 21, "diskformatqcow2": 21, "diskformatvagrantbas": 21, "diskformatvagrantlibvirt": 21, "diskformatvagrantvirtualbox": 21, "diskformatvdi": 21, "diskformatvhd": 21, "diskformatvhdfix": 21, "diskformatvhdx": 21, "diskformatvmdk": 21, "diskful": 93, "diskless": 93, "diskmod": 33, "disknam": 23, "diskprovisioningtyp": 33, "disksetup": 20, "disktyp": 33, "displai": [6, 30, 38, 60, 96], "displaynam": [1, 6, 60], "dist": [16, 18, 28, 34, 54, 63], "distinguish": [48, 60], "distribut": [1, 20, 28, 33, 34, 41, 43, 45, 47, 49, 51, 52, 56, 57, 60, 62, 64, 65, 67, 69, 71, 73, 74, 77, 85, 86, 87, 88, 89, 92], "distributor": [6, 60, 62], "distro": [1, 77], "distro_appx_metadata_packag": 34, "disturl": 61, "div": 57, "divid": 80, "dm": 60, "dm_integr": 60, "dm_integrity_meta": 60, "dm_veriti": 60, "dm_verity_credenti": 60, "dmsquash": 60, "dn": [23, 96], "dnf": [14, 16, 45, 47, 49, 60, 63], "dnf4": 60, "dnf5": 60, "dnf_arg": [14, 16], "dnsmasq": 89, "do": [18, 20, 22, 23, 30, 45, 48, 49, 50, 54, 60, 62, 67, 69, 72, 75, 79, 90, 91, 96, 97], "doc": [1, 21, 34, 38, 54, 82], "docker": [1, 9, 28, 47, 52, 58, 60, 61, 68], "dockerfil": 28, "docopt": [1, 56], "docstr": 54, "doct": 14, "document": [0, 1, 21, 23, 27, 35, 41, 43, 45, 46, 48, 57, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 76, 77, 89], "doe": [1, 2, 6, 7, 11, 12, 14, 15, 23, 25, 26, 30, 32, 33, 34, 38, 41, 46, 51, 60, 62, 64, 65, 67, 68, 71, 74, 77, 79, 80, 84, 89, 92, 93], "doesn": [21, 26, 33, 34], "dom0": [1, 8], "domain": [1, 38, 96], "domu": 86, "domx": 1, "don": [1, 14, 54, 60, 67, 69, 77, 96], "done": [1, 4, 6, 7, 11, 15, 20, 23, 29, 30, 32, 34, 38, 51, 54, 56, 60, 61, 67, 80, 81, 82, 84, 93, 94, 95, 97, 98], "dosparttable_extended_layout": 60, "doubl": [30, 54, 63], "down": [1, 30], "download": [1, 19, 28, 30, 31, 34, 39, 41, 63, 68, 77, 79], "download_from_repositori": 19, "download_loc": 39, "download_url": 1, "downloadserv": 1, "downsid": 77, "dpkg": [47, 61, 67, 73], "dracut": [1, 30, 31, 32, 46, 51, 60, 84, 87, 91, 92, 95], "dracut_module_typ": 1, "dracut_output_nam": 4, "drive": [22, 31, 69, 84, 90, 92, 98], "driven": [54, 65], "driver": [1, 20, 22, 31, 33, 51, 60], "drop": [59, 72], "due": [14, 60, 75], "dumbkbd": 29, "dump": [1, 23, 30, 46, 60, 61, 80, 84, 90], "dump_reload_package_databas": 14, "duplic": 23, "durat": 1, "dure": [1, 14, 16, 23, 30, 36, 38, 40, 41, 42, 43, 45, 46, 47, 49, 51, 60, 65, 70, 72, 80, 82], "dvd": [22, 32, 45, 60, 61, 62, 65, 89, 90, 91, 92, 98], "dvd_drive": 98, "dynam": [1, 21], "e": [1, 2, 8, 11, 12, 21, 23, 24, 34, 36, 38, 45, 51, 54, 58, 60, 61, 65, 71, 75, 77, 78, 79, 80, 83, 93, 97], "e0": [93, 94, 95], "e1000": 33, "each": [1, 16, 23, 24, 30, 33, 34, 39, 41, 43, 46, 47, 48, 49, 50, 51, 52, 53, 55, 56, 60, 61, 64, 68, 77, 78, 80, 82, 83, 98], "earli": [1, 36, 41, 43, 60], "earlier": 51, "easi": [30, 54], "easier": 38, "eat": 26, "ec2": [1, 29, 33, 60, 61, 76], "ec2_mod": 1, "ec2uploadimg": 86, "ecc": 54, "echo": [29, 49, 51, 67, 95], "edit": [30, 54, 93, 94, 95, 97], "editbootconfig": [23, 60], "editbootinstal": [23, 60], "editor": 54, "ef00": 80, "ef02": 80, "effect": [1, 6, 12, 20, 21, 23, 26, 31, 41, 43, 46, 47, 51, 60, 73, 81, 83], "effort": [54, 60, 71], "efi": [1, 6, 7, 9, 13, 20, 47, 60, 68, 82, 91], "efi_csm": 82, "efi_devic": [6, 7], "efi_image_nam": 60, "efi_mod": 1, "efi_path": 1, "eficsm": 60, "efif": 60, "efifatimages": [1, 60], "efiparts": 60, "efipartt": 60, "eif": [29, 61], "either": [1, 6, 21, 23, 33, 37, 41, 43, 46, 47, 51, 53, 54, 56, 58, 60, 63, 64, 68, 69, 77, 80, 81, 93, 95], "ejabberd": 47, "el": 1, "element": [1, 18, 23, 24, 28, 29, 30, 31, 32, 33, 38, 39, 41, 43, 45, 48, 49, 51, 53, 57, 59, 61, 77, 78, 80, 82, 83, 89], "els": [1, 30, 54], "elsewher": 75, "eltorito": 1, "emac": 54, "email": [54, 77], "emb": [9, 13, 23], "embebbed_vagrantfil": [21, 89], "embed": [1, 6, 22, 23, 30, 47, 60, 62, 90, 92], "embed_integrity_metadata": 60, "embed_verity_metadata": 60, "embedded_vagrantfil": 89, "empir": [1, 23], "empti": [1, 4, 12, 14, 20, 21, 23, 57, 60, 79], "emu": 60, "emul": [22, 46, 60], "en": [30, 34, 77, 79, 93], "en_u": [60, 68], "enabl": [1, 14, 16, 29, 30, 33, 34, 46, 51, 54, 60, 77, 78, 96], "enclav": [1, 27, 61], "enclave_format": [1, 29], "enclos": [41, 43], "encod": [60, 68, 77, 78, 89], "encount": 46, "encourag": 77, "encrypt": [1, 53, 54, 60, 76], "end": [1, 12, 22, 25, 45, 46, 47, 49, 51, 60, 61, 65, 75, 77, 80, 82], "endian": 1, "enforc": 75, "engin": [21, 33, 60, 61, 76], "enough": [1, 11, 64, 72, 84], "ensur": [23, 47, 54, 58, 60, 89], "ensure_empty_tmpdir": [10, 60], "enter": [1, 43, 46, 54, 65, 88, 89], "enterpris": [51, 60, 77], "entir": [1, 2, 12, 34], "entiti": 57, "entri": [1, 6, 15, 23, 26, 30, 33, 41, 43, 51, 56, 60, 81, 82, 94, 95], "entry_command": 10, "entry_point": 56, "entry_subcommand": 10, "entrypoint": 28, "env": [28, 36], "environ": [1, 4, 6, 10, 14, 16, 23, 28, 29, 31, 36, 38, 45, 46, 47, 56, 58, 60, 61, 62, 65, 66, 73, 74, 75, 76, 84, 89, 93], "epoch": 61, "equal": [1, 6, 30], "equival": 28, "erof": 60, "erofscompress": 60, "error": [1, 14, 16, 36, 38, 41, 43, 45, 46, 51, 52, 54, 77], "error_avail": 1, "errorcod": 1, "errorfilt": 1, "esc": 91, "escap": [1, 38], "esp": [6, 60], "especi": [47, 73, 77], "essenti": 45, "establish": [29, 45, 60], "etc": [1, 6, 23, 30, 38, 45, 46, 50, 51, 55, 57, 60, 61, 74, 75, 80, 81, 82, 83, 86, 93, 95, 96, 97], "etc_volum": 83, "eth0": 89, "etherd": [93, 94, 95], "ethernet": [32, 93, 94, 95], "etre": 1, "europ": 60, "evalu": [1, 14, 21, 23, 41, 43, 60], "even": [6, 54, 60, 62, 63, 83, 93], "eventu": [39, 46, 60, 83], "everi": [1, 24, 30, 40, 46, 54, 60, 77, 92], "everyth": [1, 52, 54, 75], "eviron": 1, "ex": 34, "exact": [33, 52, 60, 82], "exactli": [67, 79], "examin": 1, "exampl": [1, 10, 22, 23, 25, 28, 30, 31, 32, 33, 34, 36, 37, 41, 43, 45, 46, 47, 48, 49, 51, 52, 54, 55, 57, 58, 60, 61, 67, 68, 69, 72, 73, 74, 77, 79, 80, 81, 82, 89, 93, 94, 95, 96, 98], "exc_image_base_nam": [47, 48, 49, 53, 60, 61, 84, 89, 90, 91, 94, 95], "exc_repo": 49, "exce": [1, 23], "exceed": 23, "except": [21, 23, 34, 41, 51, 54, 57, 60, 75, 93, 94, 95], "except_for": 1, "exclud": [1, 2, 10, 12, 23, 24, 25, 26, 47, 52, 78], "exclude_doc": 17, "exclude_fil": 1, "excludedoc": 1, "exclus": [14, 32], "execut": [1, 23, 28, 34, 45, 46, 51, 58, 60, 61, 65, 77, 78, 81], "exercis": 75, "exfat": 92, "exist": [1, 2, 6, 16, 19, 20, 21, 23, 26, 28, 30, 31, 34, 35, 41, 42, 43, 45, 46, 51, 52, 54, 55, 56, 57, 58, 60, 61, 62, 63, 64, 65, 66, 67, 68, 72, 81, 82, 89, 91, 92, 96, 97], "exit": [1, 28, 51, 72], "expand": [27, 38, 60, 61, 82, 84, 87], "expans": [30, 77], "expect": [1, 7, 14, 23, 31, 33, 34, 38, 45, 48, 49, 52, 56, 60, 61, 65, 67, 74, 89, 94, 95, 96], "expens": 58, "experi": [51, 77], "experiment": 67, "expert": 54, "expir": [54, 60], "explain": [28, 29, 30, 31, 32, 33, 34, 59, 60, 64, 75, 84, 93], "explan": [10, 28, 83], "explicit": [20, 26, 60], "explicitli": [1, 33, 46, 47, 51, 77], "export": [1, 23, 46, 47, 55, 92, 93, 94, 95], "export_modprobe_setup": 23, "export_package_chang": 23, "export_package_list": 23, "export_package_verif": 23, "exportnam": 95, "expos": [28, 67, 68], "expose_port": 10, "express": [1, 14, 23, 60], "ext": [60, 74], "ext2": [9, 60, 61, 82], "ext3": [9, 60, 61, 80, 82, 93], "ext4": [9, 32, 33, 48, 55, 60, 61, 80, 82, 84, 85, 86, 87, 88, 89], "extend": [1, 9, 15, 23, 25, 46, 51, 54, 56, 60, 66, 72, 82], "extended_layout": [15, 20], "extens": [1, 31, 36, 45, 60, 61, 63, 65, 84, 88, 89], "extern": [1, 28, 45, 68], "extra": [1, 6, 14, 20, 46, 51, 54, 60, 62, 79, 80, 82, 88, 91, 96], "extra_set": 22, "extract": [1, 2, 21, 22, 23, 45, 47, 51, 77, 79, 94], "f": [24, 29, 30, 51, 52, 67, 91], "f12": 91, "f3": 93, "f74y5fygiovxxy88wqrybuer1eayjhvk": 67, "f_ok": 1, "face": [54, 67], "facil": 1, "fact": [60, 61], "factor": 23, "factori": [4, 7, 9, 10, 11, 12, 13, 14, 15, 16, 19, 21, 26, 77, 80], "fail": [1, 14, 16, 19, 23, 34, 36, 46, 60, 67, 72, 77], "failsaf": [1, 6, 8, 60], "failsafe_boot_entry_request": 6, "failsafe_boot_opt": 60, "failur": [1, 47, 51], "fallback": 32, "fals": [1, 4, 6, 7, 8, 9, 10, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 25, 26, 30, 32, 33, 41, 43, 49, 54, 60, 68, 80, 83, 84, 85, 86, 87, 88, 89], "famili": 60, "familiar": 65, "far": [15, 31, 93], "fashion": [65, 77], "fast": 67, "fat": [6, 12, 13, 60], "fat16": 60, "fat32": [32, 46, 60, 76, 92], "fatal": 46, "fb": 34, "fba": 60, "fdasd": 15, "fdisk": [15, 47], "featur": [2, 30, 32, 33, 34, 47, 51, 52, 60, 63, 77, 78, 80, 81, 82, 91, 92], "fedora": [14, 18, 47, 60, 62, 63], "fedoraproject": 29, "fedpkg": 54, "feedback": 67, "feel": 60, "fetch": [23, 30, 32, 49, 60, 67, 74, 93], "fetch_command": 1, "fetch_onli": [1, 60], "few": [68, 72], "ffffffff": 93, "fh": 11, "fi": [51, 97], "field": [1, 4, 20, 23, 60, 61, 96], "file": [1, 2, 4, 6, 8, 9, 10, 12, 13, 16, 17, 19, 20, 21, 22, 23, 24, 25, 26, 28, 29, 30, 31, 32, 33, 34, 36, 38, 39, 41, 42, 43, 45, 46, 47, 49, 51, 54, 56, 57, 58, 59, 61, 62, 64, 65, 67, 69, 72, 75, 76, 77, 78, 79, 80, 82, 83, 86, 88, 89, 92, 94, 95, 96, 97, 98], "file_list": 2, "file_nam": 23, "file_path": 60, "filenam": [1, 2, 4, 10, 12, 13, 20, 23, 24, 25, 26, 38, 39, 41, 43, 45, 47, 51, 55, 59, 60, 77, 92, 96], "filepath": [1, 60], "files_to_append": 2, "filesize_mbyt": [20, 55], "filesystem": [0, 1, 4, 6, 11, 13, 20, 23, 25, 26, 30, 31, 32, 33, 34, 38, 41, 43, 45, 46, 47, 48, 51, 52, 55, 60, 61, 67, 68, 70, 72, 75, 76, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 91, 92, 93], "filesystem_check": 83, "filesystem_nam": [12, 26], "filesystembas": [9, 12], "filesystembtrf": 12, "filesystembuild": 9, "filesystemext2": 12, "filesystemext3": 12, "filesystemext4": 12, "filesystemfat16": 12, "filesystemfat32": 12, "filesystemisof": 12, "filesystemsetup": 12, "filesystemsquashf": 12, "filesystemxf": 12, "filet": 1, "fill": [54, 72], "fillup": 97, "filter": [1, 46], "final": [1, 23, 45, 47, 49, 51, 58, 60, 64, 65, 72, 86], "financi": 29, "find": [1, 30, 45, 46, 54, 59, 62, 69, 72, 93], "fine": [45, 65, 77], "fingerprint": 86, "finish": [33, 45, 89], "firefox": 63, "firmwar": [7, 13, 52, 60, 68, 80, 82, 86, 90, 91], "firmware_inst": 7, "first": [1, 4, 15, 19, 26, 28, 30, 33, 38, 41, 43, 45, 46, 51, 53, 54, 57, 60, 64, 68, 74, 76, 77, 80, 81, 82, 89, 93, 96], "firstboot": [51, 97], "fit": [1, 41, 84, 96], "fix": [21, 23, 26, 33, 54, 60, 80, 82, 85, 93], "fixtur": 58, "flag": [1, 15, 21, 23, 30, 32, 54, 60, 78], "flag_nam": [1, 15], "flat": 93, "flavor": [77, 78], "flaw": 60, "flexibl": [61, 81, 82], "flip": 80, "float": 23, "fmt": 1, "focu": 75, "fog": 96, "fold": 68, "folder": [1, 21, 45, 47, 51, 65, 67, 69, 77, 89, 92], "follow": [1, 11, 16, 18, 21, 22, 23, 24, 28, 29, 30, 31, 32, 33, 34, 38, 39, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 60, 61, 62, 63, 67, 68, 69, 72, 74, 75, 77, 78, 79, 80, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98], "follow_link": 23, "font": 1, "foo": 60, "foo_app": 47, "foo_app_sourc": 47, "foo_profil": 77, "foobar": [10, 58], "forbidden": 1, "forc": [1, 14, 23, 46, 51, 60], "force_mbr": 60, "force_res": 46, "force_s": 85, "force_trailing_slash": 25, "foreign": 68, "forget": 77, "form": [1, 6, 14, 23, 24, 39, 53, 59, 60, 62, 77, 82, 94, 95], "format": [1, 9, 18, 21, 23, 25, 28, 29, 32, 33, 34, 36, 38, 39, 41, 43, 45, 46, 47, 48, 49, 52, 53, 54, 55, 57, 60, 64, 68, 69, 76, 85, 87, 89, 92, 93], "format_messag": 1, "format_nam": 21, "format_to_variable_valu": 23, "formatopt": [33, 60, 85], "formatt": 1, "former": [1, 31], "fortun": 92, "forward": [1, 21, 29, 33, 54], "found": [1, 9, 13, 18, 21, 23, 32, 38, 45, 49, 51, 54, 57, 60, 63, 73, 74, 77, 79, 82, 87, 94, 95], "fourth": 60, "fragment": 23, "framework": [33, 38, 60, 61, 85, 86, 87, 89], "franki": 56, "free": [1, 30, 37, 39, 46, 54, 60, 64, 80, 82, 83, 89], "freespac": [30, 83], "friend": 15, "from": [1, 4, 6, 7, 9, 10, 11, 12, 13, 14, 15, 19, 20, 21, 22, 23, 24, 25, 26, 28, 29, 30, 31, 32, 33, 34, 36, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 51, 52, 54, 55, 56, 57, 59, 60, 61, 62, 64, 65, 67, 72, 73, 74, 75, 76, 77, 79, 80, 82, 84, 87, 89, 90, 91, 93, 96, 98], "fsbteb0": 67, "fscreateopt": [1, 60, 74], "fsmountopt": [1, 60], "fstab": [23, 26, 60, 76, 80, 82], "fstype": 60, "ftp": [41, 49, 60, 93, 96], "fulfil": 1, "full": [6, 46, 54, 60, 69, 88], "fulli": [45, 51, 60, 65, 77, 88], "fullsiz": 1, "function": [1, 21, 23, 45, 46, 54, 55, 58, 60, 66, 68, 73, 75, 80, 89, 94, 95, 96], "further": [1, 4, 14, 20, 29, 32, 33, 34, 36, 38, 45, 47, 48, 51, 54, 58, 60, 61, 65, 74, 75, 77, 78, 81, 84, 85, 86, 87, 88, 89, 90, 91, 92, 94, 95], "furthermor": [34, 48, 77, 89], "fuse": 67, "futher": 33, "futur": 45, "g": [1, 2, 8, 11, 12, 21, 23, 24, 33, 36, 37, 38, 45, 54, 60, 61, 65, 71, 75, 78, 79, 80, 82, 83, 89, 93], "gap": 82, "gawk": 79, "gb": [1, 22, 33, 37, 60], "gce": [33, 60, 87], "gcm": 60, "gdisk": [15, 82], "geco": 86, "gen": 54, "gener": [1, 4, 11, 21, 22, 30, 31, 35, 39, 41, 43, 45, 46, 49, 51, 53, 54, 60, 62, 63, 64, 65, 66, 68, 73, 74, 77, 83, 89, 90, 91, 92, 93, 94, 95, 96], "geniu": 56, "geometri": [1, 30, 37, 60, 61, 82, 87], "get": [1, 6, 17, 19, 20, 21, 22, 25, 56, 57, 60, 61, 74, 77, 79, 80, 82, 84, 87, 88, 89, 93], "get_": 6, "get_additional_metadata": 21, "get_additional_vagrant_config_set": 21, "get_archive_image_typ": 1, "get_archives_target_dir": 1, "get_attribut": 1, "get_bios_image_nam": 1, "get_bios_module_directory_nam": 1, "get_blkid": 25, "get_bls_loader_entries_dir": 1, "get_boot_cmdlin": 6, "get_boot_description_directori": 4, "get_boot_image_description_path": 1, "get_boot_image_strip_fil": 1, "get_boot_label": 20, "get_boot_nam": 4, "get_boot_path": 6, "get_boot_them": 6, "get_boot_timeout_second": 6, "get_bootloader_config_opt": 1, "get_bootloader_install_opt": 1, "get_bootloader_opt": 1, "get_bootloader_shim_opt": 1, "get_bootstrap_arch": 1, "get_bootstrap_archives_target_dir": 1, "get_bootstrap_collect": 1, "get_bootstrap_collection_typ": 1, "get_bootstrap_fil": 1, "get_bootstrap_ignore_packag": 1, "get_bootstrap_packag": 1, "get_bootstrap_package_nam": 1, "get_bootstrap_packages_sect": 1, "get_bootstrap_product": 1, "get_build_type_bootloader_bl": 1, "get_build_type_bootloader_consol": 1, "get_build_type_bootloader_nam": 1, "get_build_type_bootloader_sect": 1, "get_build_type_bootloader_securelinux_sect": 1, "get_build_type_bootloader_serial_line_setup": 1, "get_build_type_bootloader_settings_sect": 1, "get_build_type_bootloader_targettyp": 1, "get_build_type_bootloader_timeout": 1, "get_build_type_bootloader_timeout_styl": 1, "get_build_type_bootloader_use_disk_password": 1, "get_build_type_bundle_format": 1, "get_build_type_containerconfig_sect": 1, "get_build_type_format_opt": 1, "get_build_type_machine_sect": 1, "get_build_type_nam": 1, "get_build_type_oemconfig_sect": 1, "get_build_type_partitions_sect": 1, "get_build_type_s": 1, "get_build_type_spare_part_fs_attribut": 1, "get_build_type_spare_part_s": 1, "get_build_type_system_disk_sect": 1, "get_build_type_unpartitioned_byt": 1, "get_build_type_vagrant_config_sect": 1, "get_build_type_vmconfig_entri": 1, "get_build_type_vmdisk_sect": 1, "get_build_type_vmdvd_sect": 1, "get_build_type_vmnic_entri": 1, "get_buildservice_env_nam": 1, "get_bundle_compress": 1, "get_byte_s": 20, "get_canonical_volume_list": 26, "get_collect": 1, "get_collection_modul": 1, "get_collection_typ": 1, "get_command": 1, "get_command_arg": 1, "get_common_functions_fil": 1, "get_contain": 1, "get_container_base_image_tag": 1, "get_container_compress": 1, "get_container_config": 1, "get_container_image_typ": 1, "get_container_nam": 11, "get_containers_sect": 1, "get_continue_on_timeout": 6, "get_credentials_verification_metadata_signing_key_fil": 1, "get_custom_rpm_bootstrap_macro_nam": 1, "get_custom_rpm_image_macro_nam": 1, "get_custom_rpm_macros_path": 1, "get_default_boot_mbyt": 1, "get_default_boot_timeout_second": 1, "get_default_bootload": 1, "get_default_container_created_bi": 1, "get_default_container_nam": 1, "get_default_container_subcommand": 1, "get_default_container_tag": 1, "get_default_disk_start_sector": 1, "get_default_efi_boot_mbyt": 1, "get_default_efi_partition_table_typ": 1, "get_default_firmwar": 1, "get_default_inode_s": 1, "get_default_legacy_bios_mbyt": 1, "get_default_live_iso_root_filesystem": 1, "get_default_live_iso_typ": 1, "get_default_package_manag": 1, "get_default_packager_tool": 1, "get_default_prep_mbyt": 1, "get_default_uri_typ": 1, "get_default_video_mod": 1, "get_default_volume_group_nam": 1, "get_derived_from_image_uri": 1, "get_description_sect": 1, "get_devic": [20, 26], "get_disabled_runtime_check": 1, "get_discoverable_partition_id": [1, 20], "get_disk_format_typ": [1, 21], "get_disk_image_typ": 1, "get_disk_start_sector": 1, "get_disksize_mbyt": 20, "get_distribution_name_from_boot_attribut": 1, "get_dracut_conf_nam": 1, "get_drivers_list": 1, "get_ec2_capable_firmware_nam": 1, "get_efi_capable_firmware_nam": 1, "get_efi_image_nam": 1, "get_efi_label": 20, "get_efi_module_directory_nam": 1, "get_efi_partition_s": 1, "get_efi_vendor_directori": 1, "get_enclaves_image_typ": 1, "get_entry_nam": 6, "get_error_cod": 1, "get_error_detail": 14, "get_error_output": 1, "get_exclude_list_for_non_physical_devic": 1, "get_exclude_list_for_removed_files_detect": 1, "get_exclude_list_for_root_data_sync": 1, "get_exclude_list_from_custom_exclude_fil": 1, "get_extension_xml_data": [1, 57], "get_failsafe_kernel_opt": 1, "get_filesystem": 25, "get_filesystem_image_typ": 1, "get_firmware_typ": 1, "get_format": 25, "get_frag": 23, "get_fs_create_option_list": 1, "get_fs_mount_option_list": 1, "get_fstab": [12, 26], "get_gfxmod": 6, "get_global_arg": 1, "get_grub_basic_modul": 1, "get_grub_bios_core_load": 1, "get_grub_bios_modul": 1, "get_grub_boot_directory_nam": 1, "get_grub_custom_argu": 1, "get_grub_efi_font_directori": 1, "get_grub_efi_modul": 1, "get_grub_ofw_modul": 1, "get_grub_path": 1, "get_grub_s390_modul": 1, "get_host_key_certif": 1, "get_host_templ": 17, "get_id": [15, 23], "get_ignore_packag": 1, "get_image_packages_sect": 1, "get_image_templ": 17, "get_image_vers": 1, "get_imported_root_imag": 1, "get_include_section_reference_file_nam": 1, "get_initrd_system": 1, "get_install_image_boot_default": 6, "get_install_templ": 8, "get_install_volume_id": 1, "get_installmedia_initrd_modul": 1, "get_iso_boot_path": 1, "get_iso_grub_load": 1, "get_iso_grub_mbr": 1, "get_iso_media_tag_tool": 1, "get_iso_templ": 8, "get_iso_tool_categori": 1, "get_kernel": 23, "get_kis_image_typ": 1, "get_label": 25, "get_legacy_bios_partition_s": 1, "get_live_dracut_modules_from_flag": 1, "get_live_image_typ": 1, "get_live_iso_persistent_boot_opt": 1, "get_local": 1, "get_logfil": 1, "get_luks_credenti": 1, "get_luks_format_opt": 1, "get_luks_key_length": 1, "get_lvm_overhead_mbyt": 1, "get_mapper_tool": 1, "get_max_size_constraint": 1, "get_menu_entry_install_titl": 6, "get_menu_entry_titl": 6, "get_min_partition_mbyt": 1, "get_min_volume_mbyt": 1, "get_mok_manag": 1, "get_mountpoint": [12, 26], "get_multiboot_install_templ": 8, "get_multiboot_iso_templ": 8, "get_obs_api_credenti": 1, "get_obs_api_server_url": 1, "get_obs_download_server_url": 1, "get_oci_archive_tool": 1, "get_oemconfig_oem_multipath_scan": 1, "get_oemconfig_oem_res": 1, "get_oemconfig_oem_systems": 1, "get_oemconfig_swap_mbyt": 1, "get_oemconfig_swap_nam": 1, "get_package_chang": 1, "get_package_manag": 1, "get_package_sect": 1, "get_packages_sect": 1, "get_part_mapper_tool": 1, "get_partit": 1, "get_partition_count": 25, "get_partition_table_typ": 1, "get_pid": 1, "get_platform_nam": [1, 21], "get_preferences_sect": 1, "get_prep_partition_s": 1, "get_prepar": 1, "get_product": 1, "get_profile_fil": 1, "get_public_partition_id_map": 20, "get_publish": 1, "get_qemu_option_list": 21, "get_recovery_spare_mbyt": 1, "get_release_vers": 1, "get_removed_files_nam": 1, "get_repo_typ": 19, "get_repositories_signing_kei": 1, "get_repository_sect": 1, "get_repository_sections_used_for_build": 1, "get_repository_sections_used_in_imag": 1, "get_result": 23, "get_root_filesystem_uuid": 1, "get_root_label": 20, "get_root_partition_uuid": 1, "get_root_volume_nam": [6, 12, 26], "get_rpm_check_signatur": 1, "get_rpm_excludedoc": 1, "get_rpm_local": 1, "get_rpm_locale_filt": 1, "get_runtime_checker_metadata": 1, "get_schema_fil": 1, "get_schematron_module_nam": 1, "get_servicenam": 1, "get_set": 23, "get_shared_cache_loc": 1, "get_shim_load": 1, "get_shim_vendor_directori": 1, "get_signed_grub_load": 1, "get_size_mbyt": 12, "get_snapper_config_template_fil": 1, "get_solvable_loc": 1, "get_strip_files_to_delet": 1, "get_strip_libraries_to_keep": 1, "get_strip_list": 1, "get_strip_tools_to_keep": 1, "get_swapsize_mbyt": 1, "get_sync_opt": 1, "get_system_arch": 1, "get_system_archives_target_dir": 1, "get_system_collect": 1, "get_system_collection_typ": 1, "get_system_fil": 1, "get_system_ignore_packag": 1, "get_system_packag": 1, "get_system_product": 1, "get_target_file_path_for_format": 21, "get_temp_loc": 1, "get_templ": [21, 22], "get_to_become_deleted_packag": 1, "get_tool_nam": 13, "get_unsigned_grub_load": 1, "get_us": 1, "get_user_group": 1, "get_users_sect": 1, "get_uuid": [20, 25], "get_vagrant_config_virtualbox_guest_addit": 1, "get_vendor_grubenv": 1, "get_video_mode_map": 1, "get_volum": [1, 6, 12, 26], "get_volume_group_nam": 1, "get_volume_id": 1, "get_volume_manag": 1, "get_volume_mbs": 26, "get_xen_hypervisor": 23, "get_xsl_stylesheet_fil": 1, "get_xz_compression_opt": 1, "get_xz_opt": 1, "getlogflag": 1, "getloglevel": 1, "getroot": 57, "gfxmode": 60, "gfxterm": 60, "gib": 80, "giga": 82, "gigabyt": 33, "git": [38, 63, 64, 68, 69], "gitconfig": 54, "github": [33, 38, 54, 62, 63, 68, 69], "gitlab": 54, "give": [51, 54, 77], "given": [1, 13, 14, 18, 19, 20, 23, 24, 25, 26, 28, 30, 34, 36, 46, 51, 60, 61, 67, 68, 69, 79, 93, 94, 95], "glibc": 45, "glob": 16, "global": [1, 36, 37, 39, 40, 41, 42, 43, 44, 50, 54, 58, 60], "gnu": [2, 47], "gnupg": 79, "go": 89, "goal": [30, 73], "goe": [56, 89], "gompa": 22, "good": 77, "googl": [21, 33, 60, 61, 62, 76], "got": [1, 21, 68, 93], "gpg": [1, 49, 54, 63], "gpg2": 54, "gpgsign": 54, "gpt": [1, 20, 60], "gpt2": 92, "gpt_hybrid_mbr": 60, "gq": 54, "gracefulli": 47, "grant": 1, "graphic": [6, 8, 60], "grasp": 54, "greater": 26, "grei": 38, "group": [1, 14, 18, 23, 26, 30, 47, 53, 60, 62, 68, 75, 83, 86, 89, 93, 95], "group_a": 60, "group_add": 23, "group_b": 60, "group_c": 60, "group_exist": 23, "group_list": 60, "group_nam": 23, "groupadd": 23, "grow": [36, 72], "growpart": 86, "grub": [1, 6, 20, 30, 32, 46, 60, 74, 86, 91, 92, 96], "grub2": [1, 13, 33, 47, 60, 68, 76, 84, 85, 86, 87, 89, 96], "grub2_s390x_emu": [6, 60], "grub_directory_nam": 6, "grub_loader_typ": 1, "grub_templ": 60, "guarante": [12, 26, 60, 68], "guest": [1, 21, 29, 33, 89], "guest_os_key_map": 33, "guest_os_t": 33, "guesto": 33, "guid": [1, 20, 60, 63, 82], "guid_str": 60, "guidelin": 54, "gwip": 54, "gz": [6, 21, 23, 45, 47, 64, 65], "gzip": [2, 25, 60], "h": [1, 24, 29, 33, 36, 37, 38, 39, 40, 41, 42, 43, 44, 56], "ha": [1, 6, 7, 13, 14, 15, 21, 22, 23, 26, 30, 33, 34, 46, 47, 51, 52, 54, 56, 60, 61, 63, 67, 68, 74, 75, 77, 80, 81, 82, 83, 85, 86, 87, 90, 91, 92, 93, 94, 95, 98], "hack": 71, "had": 23, "half": [46, 60], "hand": [46, 48, 77], "handi": 60, "handl": [1, 6, 16, 23, 33, 49, 52, 56, 57, 60, 65, 74, 77, 79, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 94, 95], "handler": 1, "happen": [1, 23, 26, 36, 46, 60, 67, 81], "hard": [6, 23, 36, 47, 60, 92], "harddisk": 60, "hardli": 77, "hardwar": [30, 33, 46, 60, 62, 64, 81, 93], "has_fail": 14, "has_graph": 8, "has_initrd_support": 4, "has_iso_hybrid_cap": 13, "has_journ": 60, "has_package_chang": 1, "has_raw_disk": 21, "has_seri": 8, "hash": [9, 10, 12, 53, 60, 93], "hash_blksiz": 60, "hash_start_block": 60, "hash_typ": 60, "hashicorp": 89, "hat": 60, "have": [1, 23, 26, 28, 30, 34, 36, 43, 45, 46, 47, 51, 52, 54, 58, 60, 62, 65, 69, 72, 75, 77, 79, 82, 83, 84, 89, 93, 96], "haven": 74, "hd0": 92, "hda": 30, "header": [1, 60], "healthcar": 29, "heavili": 46, "help": [24, 36, 37, 38, 39, 40, 41, 42, 43, 44, 51, 52, 54, 56, 80, 89], "help_": 1, "helper": [1, 13, 23, 24, 51, 58], "henc": 61, "here": [6, 10, 11, 13, 15, 21, 30, 32, 34, 59, 60, 61, 63, 67, 72, 74, 77, 82, 88, 89], "heterogen": 93, "hex": [1, 23, 41, 43, 49], "hidden": [13, 60], "hidden_fil": 13, "hierachi": 1, "hierarch": 26, "high": 83, "higher": [60, 64], "highest": 49, "highli": [29, 60, 61], "hipervisor": 9, "histori": [1, 10, 34], "hkd_ca_cert": 60, "hkd_cert": 60, "hkd_revocation_list": 60, "hkd_sign_cert": 60, "hmac": 60, "hoagjawxduvgsxydqtbhxlkjniol1mgbltdbhnyhu4k": 67, "hold": [20, 26, 28, 46, 80, 84], "holder": 93, "hollywood": 56, "home": [23, 53, 60, 68, 80, 86, 89], "home_path": 23, "hook": [36, 49, 57, 60], "host": [1, 16, 20, 23, 28, 29, 30, 34, 38, 41, 43, 45, 47, 49, 51, 54, 55, 60, 63, 64, 67, 68, 70, 71, 72, 77, 79, 83, 93], "host_dir": 23, "hostnam": 22, "how": [1, 26, 27, 28, 29, 30, 31, 32, 33, 34, 41, 43, 46, 47, 51, 54, 55, 57, 60, 61, 63, 67, 68, 69, 74, 75, 77, 80, 83, 85, 86, 87, 90, 91, 92, 93, 94, 95, 96, 97, 98], "howev": [1, 20, 23, 31, 51, 60, 63, 71, 73, 75, 77, 79, 80, 81, 82, 91], "html": [21, 33, 38, 46], "http": [1, 21, 28, 29, 30, 31, 33, 34, 38, 41, 46, 49, 54, 55, 56, 57, 60, 63, 68, 69, 77, 93], "human": [23, 62, 64], "hvmloader": [33, 86], "hwversion": 33, "hybrid": [1, 9, 15, 20, 27, 30, 60, 61, 90, 91, 92, 94], "hybridpersist": [32, 60], "hybridpersistent_filesystem": [32, 60], "hyper": 85, "hypervisor": [1, 6, 8, 23, 29], "i": [1, 2, 4, 6, 7, 9, 11, 12, 13, 14, 15, 16, 18, 19, 20, 21, 22, 23, 24, 25, 26, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 67, 68, 71, 72, 73, 74, 75, 77, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 91, 92, 93, 94, 95, 96, 97, 98], "i386": [68, 96], "i585": 33, "i686": 33, "i8042": 29, "ia32_efi": 96, "ia64_efi": 96, "ib": 41, "ibgzdjkplwjff8zrq01a8ex8k2fjrqt": 67, "ibm": 60, "icon": 34, "id": [1, 6, 14, 20, 22, 23, 25, 28, 29, 30, 33, 34, 39, 46, 51, 53, 54, 60, 61, 80, 84, 86, 93], "id128": 20, "id_typ": 25, "ident": [60, 80, 92, 93], "identif": [33, 34, 60, 92], "identifi": [1, 6, 24, 29, 39, 41, 43, 60, 61, 80, 82], "identifier_from_name_attr": 82, "ifac": 95, "ifnam": [85, 86, 87], "ifor": 34, "ifup": [30, 93], "ifupdown": 79, "ignor": [1, 23, 36, 41, 43, 77, 83], "ignore_recommend": 18, "illustr": [28, 68], "im": [51, 54], "imag": [0, 1, 6, 9, 10, 11, 12, 13, 14, 16, 17, 20, 21, 22, 23, 24, 29, 35, 38, 39, 40, 41, 42, 43, 44, 47, 49, 50, 53, 55, 57, 58, 62, 64, 67, 70, 71, 73, 75, 77, 79, 80, 81, 82, 83, 84, 95, 97, 98], "image_description_directori": 97, "image_format": 21, "image_id": 23, "image_type_nam": 60, "imagebuild": 9, "imageid": [23, 60], "imageidentifi": 4, "imageinclud": [1, 23, 41, 43, 49, 60], "imageonli": [41, 43, 49, 60], "imageroot": 1, "img": [30, 33, 46, 60, 72], "immedi": 47, "impact": [60, 82], "implement": [1, 4, 6, 7, 11, 12, 13, 14, 15, 16, 19, 20, 21, 23, 24, 26, 30, 46, 51, 54, 56, 57, 60, 62, 67, 80, 89, 93, 94, 95], "import": [1, 16, 23, 29, 32, 41, 42, 43, 46, 48, 51, 54, 55, 56, 57, 60, 61, 63, 80, 86, 90, 92, 98], "import_cdroot_fil": 23, "import_descript": 23, "import_fil": 23, "import_image_identifi": 23, "import_overlay_fil": 23, "import_repositories_marked_as_imageinclud": 23, "import_system_description_el": 4, "import_trusted_kei": 16, "importlib": 1, "imposs": [1, 77], "improv": 58, "in_sub_dir": 6, "inact": 60, "includ": [1, 4, 9, 13, 14, 18, 21, 22, 23, 28, 29, 30, 31, 33, 34, 36, 38, 45, 46, 47, 49, 50, 51, 54, 61, 62, 63, 64, 65, 77, 80, 82, 88, 89, 95], "include_fil": 4, "include_modul": 4, "include_unpartit": 1, "inclus": [47, 54, 60], "incompat": [54, 67, 70], "incomplet": [1, 23], "inconsist": [1, 23, 41, 51, 74], "incorpor": [47, 60], "increas": [1, 23], "increment": 60, "incur": 60, "indent": 22, "independ": [23, 47, 68, 81], "index": 63, "indic": [1, 4, 6, 13, 14, 15, 19, 24, 30, 41, 43, 60, 82, 83, 93], "indirect": [58, 73], "indirectli": 58, "individu": [6, 52, 58, 60, 61, 93, 98], "infer": 25, "influenc": [32, 60, 73, 93, 94], "info": [1, 35, 38, 51], "infofilt": 1, "inform": [1, 4, 6, 12, 14, 16, 18, 19, 20, 21, 22, 23, 24, 25, 26, 29, 31, 32, 33, 34, 36, 38, 39, 40, 41, 43, 45, 46, 49, 51, 57, 58, 59, 60, 61, 64, 65, 67, 68, 71, 74, 75, 79, 81, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98], "infrastructur": [11, 30, 31, 76], "inherit": [1, 48, 56], "ini": 1, "init": [11, 23, 29, 46, 51, 79, 86, 87, 89], "init_iso_creation_paramet": 13, "initi": [1, 4, 6, 7, 11, 12, 14, 15, 16, 21, 23, 26, 30, 41, 43, 45, 46, 47, 51, 54, 60, 64, 65, 79, 93], "initramf": 46, "initrd": [1, 4, 6, 9, 27, 29, 30, 46, 51, 60, 61, 80, 84, 87, 91, 92, 93, 94, 95], "initrd_fil": 60, "initrd_nam": 4, "initrd_system": [1, 46, 60, 84, 87], "inject": 77, "inner": 60, "inod": [1, 74], "inode_s": 74, "input": [1, 23, 60, 96], "insecur": [51, 89], "insert": [22, 33, 51, 54, 57, 60, 63, 96], "insid": [1, 17, 21, 22, 23, 28, 47, 49, 51, 54, 58, 59, 60, 64, 65, 67, 68, 72, 77, 78, 95], "inspect": [46, 54, 68], "inst_hook": 46, "inst_multipl": 46, "instal": [0, 1, 4, 6, 8, 14, 16, 23, 24, 28, 32, 33, 34, 36, 38, 41, 43, 44, 45, 46, 47, 49, 51, 52, 56, 58, 59, 60, 61, 62, 64, 65, 67, 69, 77, 79, 82, 84, 85, 86, 87, 89, 91, 92, 93, 94, 95], "install_bootstrap": 23, "install_continue_on_timeout": 60, "install_initrd": 4, "install_lang": 60, "install_media": 4, "install_packag": 23, "install_requir": 7, "install_system": 23, "installboot": [6, 60, 84], "installdevic": 46, "installed_kernel": 4, "installimagebuild": 9, "installiso": [1, 9, 30, 46, 60, 61, 84], "installkernel": 46, "installmedia": 30, "installopt": 60, "installprovidefailsaf": 60, "installpx": [1, 9, 30, 46, 60, 61], "installstick": [1, 9, 46], "instanc": [1, 4, 6, 7, 8, 9, 12, 14, 15, 16, 18, 19, 20, 21, 23, 24, 26, 28, 29, 33, 45, 49, 60, 83, 86, 87, 89], "instead": [1, 16, 25, 38, 46, 49, 54, 58, 60, 61, 62, 63, 65, 77, 89], "instmod": 46, "instruct": [30, 46, 47, 48, 54, 60, 63, 75, 77, 83, 93, 96, 97], "int": [1, 6, 12, 14, 15, 16, 20, 21, 23, 25, 26], "intanc": 26, "integ": 49, "integr": [46, 54, 60, 63, 67, 77, 79], "integrity_keyfil": 60, "integrity_legacy_hmac": 60, "integrity_metadata_key_descript": 60, "integrity_root": 9, "integritydevic": 9, "integritysetup": 60, "intel_lean_cli": 96, "intellectu": 29, "intend": [32, 60], "intent": 60, "intention": 1, "interact": [30, 46, 60, 64, 65, 67, 97], "interf": [60, 61], "interfac": [1, 12, 19, 24, 26, 57, 60, 61, 68, 77, 89, 94, 95], "interfer": 32, "intermedi": [16, 19, 23], "intern": [1, 22, 33, 41], "internal_hash": 60, "interpret": [12, 54, 60, 83], "introduc": 45, "invalid": 1, "investig": 60, "invoc": 1, "invok": [1, 12, 26, 45, 48, 49, 51, 54, 56, 60, 65, 69, 77, 89], "involv": 60, "io": [1, 68], "ip": [89, 93, 95, 96], "ipappend": 93, "iproute2": 79, "iptabl": 79, "iputil": 79, "ipx": 96, "is_buildservice_work": 1, "is_loop": [20, 26], "is_mount": 1, "is_obs_publ": 1, "is_ppc64_arch": 1, "is_prepar": 4, "is_publ": 23, "is_remot": 23, "is_root_volum": 1, "is_uptod": 19, "is_x86_arch": 1, "is_xen_guest": 1, "is_xen_serv": 1, "isc": 79, "iso": [1, 6, 8, 9, 12, 27, 30, 38, 41, 45, 46, 47, 49, 51, 52, 55, 60, 61, 62, 65, 76, 84], "iso_boot": 6, "iso_control": 22, "iso_path": 92, "iso_setup": 22, "iso_tool": 0, "isofil": 13, "isohybrid": 91, "isoinfo": 1, "isol": 29, "isomd5sum": 1, "isoscan": 46, "isotool": 13, "isotoolsbas": 13, "isotoolsxorriso": 13, "issu": [1, 14, 42, 54, 67, 70, 74, 75, 77, 89], "item": [1, 2, 46, 60], "item_to_match": 1, "items_to_complet": 1, "iter": [1, 23], "its": [1, 9, 20, 23, 24, 25, 30, 33, 39, 46, 47, 49, 51, 52, 54, 57, 59, 60, 61, 63, 65, 71, 75, 77, 79, 80, 81, 82, 83, 84, 93], "itself": [1, 4, 22, 23, 30, 46, 49, 51, 60, 61, 63, 65, 67, 68, 77, 81, 89, 93], "ix86": [1, 33, 71], "j": 24, "j3sodpotpog8pinwrx6": 67, "jammi": 72, "java": 52, "jbod": 46, "jeo": 77, "jing": 52, "job": [1, 18, 67, 75, 79], "job_nam": 18, "join": 54, "journal": 60, "json": [1, 21, 23, 77], "judg": 60, "just": [1, 26, 45, 57, 60, 69, 70, 75, 77, 79, 84], "justdoit": 56, "k": [12, 29, 57], "kb": [1, 12, 33], "kbd": 60, "kbyte": 84, "kconfig": 51, "keep": [1, 23, 25, 30, 32, 42, 46, 51, 60, 63, 71, 75, 77, 88, 91, 92], "keep_sourc": 25, "keep_source_on_compress": 25, "kei": [1, 4, 9, 10, 12, 16, 20, 23, 24, 25, 28, 41, 42, 43, 51, 54, 60, 63, 67, 86, 88, 89, 91, 92], "kept": [31, 51], "kernel": [1, 4, 6, 9, 14, 27, 28, 29, 30, 32, 46, 47, 51, 60, 61, 68, 75, 83, 85, 86, 87, 89, 91, 92, 94, 95], "kernel_fil": 60, "kernel_file_nam": 4, "kernel_filenam": 4, "kernel_hex_mod": 1, "kernel_nam": [4, 23], "kernel_typ": 23, "kernel_vers": 4, "kernelcmdlin": [29, 31, 60, 84, 85, 86, 87], "kernelnam": 23, "kexec": [9, 30, 60, 84], "keyboard": 23, "keyfil": [20, 60, 88], "keyid": 54, "keymap": 60, "keynam": 1, "keyr": [60, 88], "keytabl": [51, 68], "keyword": 1, "ki": [1, 27, 47, 52, 60, 61, 95], "kill": 1, "kisbuild": 9, "kiwi": [0, 27, 28, 29, 30, 31, 32, 33, 34, 35, 45, 46, 47, 48, 49, 50, 52, 54, 56, 58, 59, 60, 61, 62, 63, 64, 65, 67, 68, 69, 70, 71, 72, 73, 74, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 97, 98], "kiwi_": [41, 80], "kiwi_biosgrub": [20, 80], "kiwi_boot_timeout": 93, "kiwi_bootpart": [20, 80], "kiwi_bootpartclon": 20, "kiwi_bootpartclone1": 80, "kiwi_box": 72, "kiwi_boxed_plugin": 67, "kiwi_compress": 51, "kiwi_delet": 51, "kiwi_driv": 51, "kiwi_efipart": [20, 80], "kiwi_fil": 24, "kiwi_git_checkout": 67, "kiwi_homepart": 80, "kiwi_homepartclone1": 80, "kiwi_homepartclone2": 80, "kiwi_inam": 51, "kiwi_ivers": 51, "kiwi_kernel_opt": 93, "kiwi_keyt": 51, "kiwi_languag": 51, "kiwi_oembootwait": 30, "kiwi_oemreboot": 30, "kiwi_oemrebootinteract": 30, "kiwi_oemrootmb": 30, "kiwi_oemshutdown": 30, "kiwi_oemshutdowninteract": 30, "kiwi_oemsilentboot": 30, "kiwi_oemswap": 30, "kiwi_oemswapmb": 30, "kiwi_oemtitl": 30, "kiwi_oemunattend": 30, "kiwi_plugin": 56, "kiwi_preppart": 20, "kiwi_profil": 51, "kiwi_raiddev": 20, "kiwi_raidpart": 20, "kiwi_readonlypart": 20, "kiwi_relax_plugin": 56, "kiwi_rootpart": [20, 80], "kiwi_rootpartclone1": 80, "kiwi_sparepart": 20, "kiwi_stackbuild_plugin": 68, "kiwi_swappart": 20, "kiwi_timezon": 51, "kiwi_typ": 51, "kiwianymarkuppluginerror": 1, "kiwiarchivesetuperror": 1, "kiwiarchivetarerror": 1, "kiwibootimagesetuperror": 1, "kiwibootloaderconfigsetuperror": 1, "kiwibootloaderdiskpassworderror": 1, "kiwibootloadergrubdataerror": 1, "kiwibootloadergrubfonterror": 1, "kiwibootloadergrubinstallerror": 1, "kiwibootloadergrubmoduleserror": 1, "kiwibootloadergrubplatformerror": 1, "kiwibootloadergrubsecurebooterror": 1, "kiwibootloaderinstallsetuperror": 1, "kiwibootloadertargeterror": 1, "kiwibootloaderziplinstallerror": 1, "kiwibootloaderziplplatformerror": 1, "kiwibootloaderziplsetuperror": 1, "kiwibootstrapphasefail": [1, 23], "kiwibuildaherror": 1, "kiwibundleerror": 1, "kiwicommandcapabilitieserror": 1, "kiwicommanderror": 1, "kiwicommandnotfound": 1, "kiwicommandnotload": 1, "kiwicompressionformatunknown": 1, "kiwiconfigfileformatnotsupport": 1, "kiwiconfigfilenotfound": 1, "kiwicontainerbuildererror": 1, "kiwicontainerimagesetuperror": 1, "kiwicontainersetuperror": 1, "kiwicredentialserror": 1, "kiwicustompartitionconflicterror": 1, "kiwidatastructureerror": 1, "kiwidebianbootstraperror": 1, "kiwidecodingerror": 1, "kiwidescriptioninvalid": 1, "kiwideviceprovidererror": 1, "kiwidiskbootimageerror": 1, "kiwidiskformatsetuperror": 1, "kiwidiskgeometryerror": 1, "kiwidistributionnameerror": 1, "kiwienclavebootimageerror": 1, "kiwienclaveformaterror": 1, "kiwierror": 1, "kiwiextensionerror": 1, "kiwifil": 38, "kiwifileaccesserror": 1, "kiwifilenotfound": 1, "kiwifilesystemsetuperror": 1, "kiwifilesystemsyncerror": 1, "kiwiformatsetuperror": 1, "kiwihelpnocommandgiven": 1, "kiwiimageresizeerror": 1, "kiwiimportdescriptionerror": 1, "kiwiincludfilenotfounderror": 1, "kiwiinstallbootimageerror": 1, "kiwiinstallmediaerror": [1, 9], "kiwiinstallphasefail": [1, 23], "kiwiisometadataerror": 1, "kiwiisotoolerror": [1, 13], "kiwikernellookuperror": [1, 23], "kiwikisbootimageerror": [1, 9], "kiwilivebootimageerror": [1, 9], "kiwiloadcommandundefin": 1, "kiwilogfilesetupfail": 1, "kiwilogsocketsetupfail": 1, "kiwiloopsetuperror": 1, "kiwilukssetuperror": 1, "kiwimappeddeviceerror": 1, "kiwimarkupconversionerror": 1, "kiwimountkernelfilesystemserror": [1, 23], "kiwimountshareddirectoryerror": [1, 23], "kiwinotimplementederror": 1, "kiwiociarchivetoolerror": 1, "kiwioffseterror": 1, "kiwiosreleaseimporterror": 1, "kiwipackagemanagersetuperror": [1, 14], "kiwipackagesdeletephasefail": [1, 23], "kiwipartitionergptflagerror": 1, "kiwipartitionermsdosflagerror": 1, "kiwipartitionersetuperror": 1, "kiwipartitiontoosmallerror": 1, "kiwiprivilegeserror": 1, "kiwiprofilenotfound": 1, "kiwiraidsetuperror": 1, "kiwirepositorysetuperror": [1, 16], "kiwirequestedtypeerror": 1, "kiwirequesterror": [1, 14], "kiwiresizerawdiskerror": 1, "kiwiresulterror": [1, 23], "kiwirootdirexist": 1, "kiwirootimporterror": 1, "kiwirootinitcreationerror": [1, 23], "kiwirpmdirnotremoteerror": 1, "kiwiruntimeconfigfileerror": 1, "kiwiruntimeconfigformaterror": 1, "kiwiruntimeerror": 1, "kiwisatsolverjoberror": 1, "kiwisatsolverjobproblem": [1, 18], "kiwisatsolverpluginerror": 1, "kiwischemaimporterror": 1, "kiwiscriptfail": 1, "kiwiserv": 93, "kiwiservertyp": 93, "kiwisetupintermediateconfigerror": [1, 23], "kiwishellvariablevalueerror": [1, 23], "kiwisizeerror": 1, "kiwisolverrepositorysetuperror": 1, "kiwisystemdeletepackagesfail": [1, 23], "kiwisysteminstallpackagesfail": [1, 23], "kiwisystemupdatefail": [1, 23], "kiwitargetdirectorynotfound": 1, "kiwitemplateerror": 1, "kiwitypenotfound": 1, "kiwiumountbusyerror": 1, "kiwiunknownservicenam": 1, "kiwiuriopenerror": [1, 19], "kiwiuristyleunknown": [1, 23], "kiwiuritypeunknown": 1, "kiwivalidationerror": 1, "kiwivg": 83, "kiwivhdtagerror": 1, "kiwivolumegroupconflict": 1, "kiwivolumemanagersetuperror": [1, 9, 26], "kiwivolumerootiderror": 1, "kiwivolumetoosmallerror": 1, "kludg": 72, "kmgt": 46, "kmp": 89, "knife": 62, "know": [1, 52, 60, 67, 74, 93, 98], "knowledg": [65, 79], "known": [1, 23, 31, 36, 65, 96], "kvm": [21, 67, 68], "kwarg": 1, "l": [1, 10, 54, 63, 69, 92, 93], "label": [1, 10, 12, 20, 25, 26, 28, 41, 43, 55, 60, 83, 86, 93, 94, 95], "label_nam": 1, "lack": 2, "lain": 53, "land": 93, "languag": [1, 51, 60, 79], "larg": [30, 33, 52, 72, 77], "last": [40, 51, 60, 63, 77, 80, 81, 82, 94], "later": [1, 18, 23, 47, 51, 60, 68, 81, 88], "latest": [24, 36, 51, 60, 77], "latter": [21, 53, 83], "launch": [45, 60], "launcher": 34, "layer": [1, 12, 26, 32, 46, 60, 68, 95], "layout": [1, 6, 15, 20, 30, 45, 59, 60, 80, 82, 89], "lazi": 1, "ldl": 60, "lead": [1, 20, 36, 41, 47, 51, 58, 60, 68, 70, 71, 75], "leap": [28, 30, 32, 33, 38, 62, 63, 67, 68, 69, 77, 78, 83, 93], "leap_15_3": 58, "least": [1, 41, 43, 49, 60, 61, 62, 64, 84], "leav": [1, 60, 80, 82], "left": [1, 33, 34, 80], "leftov": 23, "legaci": [1, 9, 30, 31, 60, 76, 80], "legacy_bios_mod": 1, "legacyesx": 33, "len": 54, "length": 1, "less": [30, 46], "let": [30, 54, 60, 80, 84, 87, 93], "letter": [34, 54], "level": [1, 20, 22, 23, 24, 26, 38, 45, 49, 51, 52, 54, 55, 59, 60, 80, 82, 83, 93], "leverag": 80, "lib": [1, 46, 51, 60, 79, 83, 86, 97], "libburnia": 13, "libpam": 79, "librari": [1, 38, 46, 51, 83, 86], "libsolv": [1, 18], "libvirt": [21, 78, 89], "libvirtd": 89, "libvirtvagrantfil": 89, "libzypp": 16, "licens": [45, 59, 60, 61, 65], "light": [1, 38], "lightcolor": 1, "like": [1, 6, 14, 19, 25, 28, 30, 33, 34, 36, 45, 46, 47, 52, 54, 60, 61, 62, 64, 69, 73, 75, 77, 79, 80, 82, 84, 91, 92, 93, 98], "limit": [23, 30, 46, 54, 60, 62, 80, 82, 84], "line": [1, 14, 30, 31, 34, 38, 41, 43, 45, 46, 48, 50, 54, 60, 61, 62, 75, 77, 78, 93], "link": [16, 23, 51, 63, 77], "linter": 54, "linux": [1, 6, 11, 23, 27, 30, 34, 45, 46, 51, 60, 61, 64, 65, 74, 75, 77, 79, 82, 83, 88, 90, 92, 93, 94, 95], "linuxrc": [23, 46, 93], "list": [1, 2, 4, 9, 10, 11, 12, 13, 14, 15, 16, 18, 20, 21, 23, 24, 25, 26, 28, 30, 32, 33, 34, 35, 36, 41, 43, 46, 47, 48, 49, 51, 53, 54, 58, 59, 60, 61, 62, 63, 66, 67, 68, 74, 75, 77, 79, 80, 82, 83, 85, 86, 87, 88, 98], "list_iso": 13, "list_of_volum": 7, "listen": 1, "liter": [1, 6], "littl": 1, "live": [1, 6, 8, 27, 30, 38, 45, 46, 51, 52, 60, 61, 62, 65, 76, 90, 91], "live_system": 46, "liveimagebuild": 9, "livenet": 32, "liveo": 46, "ln": 51, "ln6tkw1p6uvvmuibagugnzfntdci91qw8ps1j": 67, "load": [1, 4, 6, 23, 24, 28, 29, 30, 33, 36, 46, 55, 57, 60, 61, 89, 91, 92, 94, 95], "load_boot_xml_descript": 4, "load_command": 1, "load_xml_descript": 24, "loadabl": 61, "loader": [1, 6, 13, 33, 60, 94, 95, 96], "loader_fil": 13, "local": [1, 23, 41, 45, 49, 51, 68, 86], "locat": [1, 16, 19, 23, 30, 38, 39, 41, 43, 46, 49, 50, 60, 72, 75, 81, 93, 95, 98], "lock_passwd": 86, "log": [1, 10, 38, 41, 46, 51, 55, 57, 60, 89, 96], "log_top": 1, "logfil": [1, 24, 38], "loggerschedulerfilt": 1, "logic": [1, 60, 82, 83], "login": [1, 11, 29, 60, 68, 89], "loglevel": 38, "logrecord": 1, "logsocket": 38, "long": [1, 54, 57, 75], "longer": [1, 31, 47, 60, 77, 80], "look": [1, 23, 45, 47, 49, 54, 57, 60, 61, 69, 80, 90, 91, 93], "lookup": [1, 6, 13, 23, 26, 46, 60, 82, 98], "lookup_path": [1, 6, 13], "loop": [1, 20, 26, 32, 41, 46, 51, 52, 55, 60, 92, 93], "loop0": 95, "loop_devic": 55, "loop_provid": 55, "loopback": [32, 46, 91, 92], "loopdevic": [12, 20, 55], "loos": 84, "losetup": 95, "losr": 30, "lost": [45, 91], "lot": 62, "low": [26, 82], "lower": [1, 60], "lowercas": 1, "lsblk": [90, 91], "lsilog": 33, "lsisas1068": 33, "luk": [1, 20, 46, 52, 60, 80, 88], "luks1": 60, "luks2": 60, "luks_root": 9, "luks_vers": 60, "luksdevic": [9, 20], "luksformat": 1, "lvm": [1, 20, 30, 46, 52, 60, 80, 83], "lvroot": 83, "lvswap": [1, 30], "lx": 82, "lx3vnc8zboowm6nhzqq4faqbxuh": 67, "lxboot": 80, "lxbootclone1": 80, "lxhome": 80, "lxhomeclone1": 80, "lxhomeclone2": 80, "lxml": 1, "lxroot": 80, "lxrootclone1": 80, "lyric": 56, "lz4": 60, "lzo": 60, "m": [1, 23, 29, 30, 32, 33, 37, 39, 47, 54, 60, 61, 69, 78, 82, 83, 84, 85, 86, 87, 93], "mac": [21, 22, 33], "mac_address": [22, 93], "machin": [1, 21, 22, 23, 30, 34, 45, 47, 48, 51, 61, 62, 64, 67, 68, 77, 79, 84, 86, 93, 94, 95], "machine_id": 4, "macro": [1, 14, 16, 23, 60], "made": [1, 49, 60, 62, 77, 82, 93], "magic": 51, "mai": [30, 31, 38, 45, 46, 47, 51, 58, 60, 61, 62, 63, 64, 65, 72], "mail": 62, "main": [1, 6, 13, 22, 24, 26, 36, 38, 39, 41, 43, 49, 52, 54, 55, 57, 60, 65, 77, 84], "mainli": 61, "maintain": [1, 10, 28, 34, 60, 89, 93], "mainten": 24, "major": [33, 39, 54, 60, 61, 71, 73, 74, 81, 93, 94, 95], "make": [1, 16, 20, 21, 24, 25, 28, 30, 32, 33, 34, 36, 37, 38, 41, 45, 46, 47, 48, 51, 54, 60, 63, 68, 72, 74, 75, 77, 79, 80, 81, 84, 85, 86, 87, 88, 90, 91, 93, 96], "man": [1, 23, 25, 46, 51, 56, 60], "man7": 46, "manag": [1, 14, 16, 17, 20, 23, 25, 26, 30, 41, 42, 43, 45, 47, 49, 51, 52, 54, 55, 56, 60, 61, 62, 63, 65, 68, 69, 77, 80, 82, 83], "mandatori": [33, 45, 47, 51, 53, 59, 60, 61, 68, 82, 89], "mangement": 1, "manger": 1, "mani": [23, 31, 46, 60, 61, 62, 63, 73, 80, 90, 91, 93], "manifest": 21, "manner": 54, "manual": [1, 24, 45, 54, 56, 60, 77, 78, 79, 90, 91, 93, 98], "map": [1, 6, 11, 15, 20, 26, 28, 57, 60, 72, 80, 81], "map_nam": 20, "map_partit": 20, "mappeddevic": [20, 26], "mapper": [1, 32], "mark": [1, 23, 26, 28, 32, 39, 45, 47, 58, 60], "markup": [1, 52, 60], "master": [1, 26, 60, 88], "match": [1, 14, 16, 20, 23, 24, 25, 28, 30, 34, 38, 45, 56, 60, 61, 62, 64, 65, 67, 69, 71, 79, 83, 85, 86, 87, 88, 94], "match_method": 1, "match_package_delet": 14, "match_package_instal": 14, "matcher": 1, "matrix": 62, "matter": [77, 84, 92], "mawk": 79, "max": [1, 25, 60], "max_cpu": 33, "max_memori": 33, "max_siz": 1, "maxdisk": 46, "maximum": [1, 30, 33, 46], "mb": [1, 33, 37, 46, 60], "mbr": [1, 15, 20, 23, 60, 82], "mbrid": [4, 6, 23], "mbsize": [1, 15, 20, 23, 26, 32, 46, 60], "mbyte": [1, 12, 20, 23, 60], "md": [16, 19, 20, 23, 41, 43, 49, 55, 68, 77, 79], "md0": 93, "md1": 93, "md5": [25, 30, 93], "md5sum": 93, "mdadm": 20, "mdraid": 60, "mdx": 20, "me": 53, "mean": [1, 23, 30, 31, 40, 41, 43, 46, 47, 49, 51, 55, 57, 60, 61, 68, 69, 75, 84, 90, 91, 92, 94, 95], "meaningless": 60, "meant": 20, "mechan": [52, 57, 89], "media": [1, 4, 6, 8, 9, 32, 45, 52, 60, 61, 62, 65, 89, 98], "media_path": 13, "media_tag_tool": 1, "mediacheck": [1, 13, 32, 60], "meet": [46, 85, 86, 87], "mega": 82, "megabyt": [1, 33, 83], "member": 60, "memori": [22, 29, 32, 33, 72, 84], "memory_setup": 22, "mention": [57, 61, 67, 68, 71, 75, 80], "menu": [6, 30, 60, 63, 90, 91, 92, 96], "merg": 19, "meson": 47, "messag": [1, 16, 23, 30, 38, 51, 60, 86], "message_format": 1, "met": 1, "meta": [6, 13, 34, 38, 77], "meta_data": 12, "metadata": [1, 6, 9, 11, 18, 19, 21, 23, 25, 28, 33, 34, 36, 41, 42, 43, 60, 61, 73, 74, 80, 89], "metadata_path": [34, 60], "metalink": [16, 29, 60], "method": [1, 4, 6, 7, 11, 12, 13, 14, 15, 16, 19, 20, 21, 22, 23, 24, 25, 26, 47, 51, 54, 56, 60, 62, 63, 77, 79, 81, 84, 93, 96], "mib": 80, "microdnf": 60, "microo": 68, "microsoft": [1, 33, 34, 60, 61, 76], "might": [14, 46, 51, 60, 63, 67, 74, 77, 81, 85, 86, 87, 88, 89], "migrat": 86, "mime": [1, 19], "min_cpu": 33, "min_memori": 33, "min_vers": 1, "mind": [30, 42, 46, 51, 63, 71, 77], "minim": [23, 60, 93], "minimum": [1, 26, 33, 60, 64], "minor": [39, 54, 60, 61, 94, 95], "mirror": [20, 29, 60, 93], "mirrorlist": [16, 60], "miss": [1, 20, 36, 38, 51, 60, 89], "mix": [6, 54], "mkconfig": [6, 60], "mkdir": [30, 46, 47, 68, 95, 97], "mke2f": [60, 74], "mkf": [60, 74], "mkimag": 96, "mknetdir": 96, "mkpac": 79, "mksquashf": 60, "ml": 60, "mnt": 94, "moddir": 46, "mode": [1, 6, 20, 23, 30, 32, 33, 46, 51, 54, 58, 60, 91, 92, 93, 95], "modern": [11, 51], "modif": [23, 45, 49, 51, 60, 61, 77, 81], "modifi": [23, 30, 45, 49, 51, 53, 54, 55, 60, 72, 75, 80, 81, 82, 89], "modprob": 23, "modul": [30, 32, 36, 46, 52, 54, 55, 56, 58, 60, 74, 86, 87, 89, 94, 95, 96, 97, 98], "modular": 60, "module_hotfix": 49, "mok": 1, "moment": [57, 60, 91], "monolithicflat": 33, "monolithicspars": 33, "more": [1, 6, 20, 23, 28, 29, 30, 36, 38, 45, 46, 49, 51, 54, 56, 59, 60, 61, 62, 63, 67, 68, 73, 74, 75, 79, 80, 86, 90, 92], "moreov": 2, "most": [12, 38, 46, 63, 73, 75, 77, 80, 81, 89, 91, 92, 93], "mostli": [46, 60, 65], "mount": [1, 6, 12, 23, 26, 38, 41, 46, 49, 51, 60, 67, 72, 80, 81, 82, 83, 84, 86, 88, 91, 92, 93, 94, 98], "mount_kernel_file_system": 23, "mount_list": 26, "mount_opt": 12, "mount_shared_directori": 23, "mount_stack": 23, "mount_volum": [12, 26], "mountabl": 9, "mountmanag": [1, 12, 26], "mountpoint": [1, 20, 26, 28, 80, 82, 83, 93], "move": [4, 14, 60, 68, 77, 82], "move_to_root": 1, "msdo": [1, 20, 60], "much": [54, 59, 77], "multiboot": 1, "multibuild": [77, 78], "multio": 92, "multipath": [1, 84, 86], "multipl": [1, 24, 28, 30, 33, 38, 40, 41, 42, 43, 44, 45, 47, 48, 53, 54, 57, 59, 60, 61, 68, 77, 83], "must": [1, 13, 16, 21, 22, 30, 34, 36, 38, 39, 41, 42, 43, 46, 48, 49, 50, 51, 52, 54, 56, 57, 59, 60, 67, 75, 77, 78, 80, 82, 84, 85, 86, 87, 89, 91, 92, 93, 94, 95, 96], "mutablemap": 1, "mutat": 58, "my": [34, 46, 47, 54, 89], "my_featur": 57, "my_plugin": 57, "my_plugin_a": 57, "my_plugin_b": 57, "my_tmp": 55, "myimag": [28, 29, 30, 31, 32, 33, 34, 38, 67, 69, 78], "myleap": 68, "mypx": 93, "myrepo": 55, "mytwtodai": 68, "myvagrantfil": 89, "n": [20, 23, 30, 39, 54, 58, 61, 93, 94, 95], "name": [1, 2, 4, 6, 7, 9, 10, 11, 12, 13, 14, 15, 16, 18, 19, 20, 21, 22, 23, 24, 25, 26, 28, 29, 30, 32, 33, 34, 38, 39, 41, 43, 44, 45, 46, 47, 48, 49, 51, 53, 54, 57, 59, 60, 61, 63, 64, 65, 67, 68, 77, 78, 79, 80, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97], "name_pattern": 61, "name_wit_a_": 23, "namedcollect": 1, "namedtupl": [1, 14], "namespac": [1, 48, 55, 56, 57, 60, 78], "namespace_nam": 1, "nativ": [28, 33, 46, 47, 51, 60, 71, 79], "natur": 60, "navig": 54, "nbd": [93, 95], "nbd0": 93, "nbdroot": 93, "nbywfl0": [53, 68], "ncpu": 33, "neal": 22, "nearli": 60, "necessari": [46, 47, 51, 54, 60, 77, 89], "need": [1, 4, 6, 7, 11, 12, 14, 18, 20, 21, 22, 23, 26, 30, 34, 46, 47, 51, 52, 56, 57, 58, 60, 61, 62, 63, 64, 67, 68, 69, 72, 74, 79, 80, 81, 82, 84, 86, 89, 91, 92, 93, 96, 97], "need_boot_partit": 20, "neither": 31, "nest": [1, 60], "net": [85, 86, 87, 96], "net_default_serv": 96, "netbas": 79, "netboot": [31, 46, 76], "network": [9, 22, 32, 38, 47, 60, 61, 62, 65, 76, 81, 89, 93], "network_connection_typ": 22, "network_driv": 22, "network_mac": 22, "network_setup": 22, "never": [23, 80, 83], "nevertheless": 77, "new": [1, 4, 7, 9, 10, 11, 12, 13, 14, 15, 16, 19, 20, 21, 22, 23, 24, 26, 28, 30, 32, 37, 38, 41, 43, 45, 46, 47, 54, 55, 57, 60, 61, 67, 68, 75, 79, 82, 93, 94, 98], "next": [35, 45, 60, 62, 63, 66, 68, 75, 77, 79, 89, 94, 96], "nf": [81, 93], "nfsroot": 93, "ng": [0, 1, 27, 28, 29, 30, 31, 32, 33, 34, 35, 45, 46, 47, 48, 49, 50, 52, 54, 56, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 97, 98], "nice": 75, "ninja": 47, "nitro": [27, 61], "no_tmpdir": 1, "noaux": 29, "nocloud": 86, "node": [1, 6, 12, 20, 23, 25, 26, 30, 60, 75, 94, 95], "nograph": 29, "nomodeset": 93, "nomux": 29, "non": [1, 6, 32, 46, 51, 60, 62, 67, 83, 97], "none": [1, 2, 4, 6, 7, 9, 10, 11, 12, 13, 14, 15, 16, 18, 19, 20, 21, 22, 23, 24, 25, 26, 30, 54, 60, 61, 86], "nonnegativeinteg": 60, "noop": 4, "nopasswd": 86, "nopnp": 29, "nor": 31, "normal": [23, 31, 36, 42, 43, 46, 51, 60, 61, 91, 92], "notabl": 77, "note": [1, 6, 20, 21, 23, 26, 33, 34, 36, 46, 47, 49, 54, 60, 63, 65, 71, 77, 78, 89, 91], "noth": [6, 12, 14, 15, 21, 22, 30, 51], "notif": 77, "notifi": 60, "notrunc": 30, "notset": 38, "now": [1, 29, 32, 45, 56, 60, 69, 77, 79, 87, 93, 94, 95, 96], "nproc": 54, "number": [1, 4, 6, 12, 14, 15, 20, 22, 23, 25, 28, 33, 34, 38, 39, 41, 43, 52, 54, 60, 61, 68, 76, 77, 80, 82, 94, 95, 98], "number_of_process": 54, "number_of_thread": 58, "numer": [2, 33, 38, 53, 60], "numvcpu": 33, "nutshel": 21, "nvqf": 67, "o": [1, 16, 33, 34, 46, 49, 51, 52, 57, 60, 62, 64, 69, 84, 96], "oasi": 57, "ob": [1, 28, 30, 32, 33, 34, 38, 41, 49, 60, 67, 68, 69, 73, 78, 79], "object": [1, 2, 4, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26], "obs_project": 77, "obsject": 9, "obsrepositori": [49, 60, 77, 79], "obtain": [1, 60, 77], "occasion": 60, "occupi": 30, "occur": [1, 30, 45, 46, 52, 65], "oci": [1, 9, 23, 47, 52, 60, 61, 68], "ociconfig": 10, "oem": [1, 9, 32, 33, 37, 38, 45, 46, 47, 48, 51, 52, 60, 61, 67, 68, 72, 78, 80, 82, 83, 84, 85, 86, 87, 88, 89, 93], "oem_qcow_format": 60, "oem_vmdk_format": 60, "oemconfig": [1, 30, 33, 46, 68, 80, 84, 85, 86, 87, 88, 89], "off": [1, 29, 30, 34, 51, 54, 60, 61, 86, 93], "offer": [1, 33, 37, 46, 51, 55, 57, 60, 68, 77, 82, 84, 90, 91], "offici": [46, 63, 89], "offlin": 72, "offset": [1, 6, 23], "often": [31, 62, 65], "ofw": [1, 60], "ofw_mod": 1, "old": [15, 36, 60, 96], "older": [51, 62, 74, 77], "omit": [4, 30, 49, 54, 58, 77, 89], "omit_modul": 4, "onc": [1, 23, 33, 34, 46, 51, 54, 60, 65, 68, 86, 88, 89, 90, 91, 93, 94, 95, 96, 97, 98], "one": [1, 6, 16, 20, 21, 22, 23, 26, 28, 30, 32, 33, 38, 41, 43, 45, 46, 47, 48, 49, 51, 52, 57, 59, 60, 61, 62, 64, 67, 68, 69, 70, 71, 77, 79, 80, 81, 82, 86, 89, 93, 94, 95], "ones": [24, 47, 51, 60, 75, 77, 81], "onli": [1, 4, 6, 7, 12, 14, 16, 20, 21, 23, 26, 29, 30, 31, 32, 33, 34, 36, 39, 40, 41, 42, 43, 45, 47, 48, 49, 51, 54, 58, 59, 60, 61, 62, 65, 68, 75, 77, 79, 80, 81, 83, 84, 88, 89, 93, 94, 95, 96], "onlin": 77, "only_for": 1, "onlyrequir": [1, 47, 60], "onto": [30, 65, 90, 91, 92], "op": 60, "opal": [1, 60], "opal_mod": 1, "open": [1, 23, 33, 34, 41, 47, 49, 54, 60, 61, 62, 63, 67, 68, 73, 75, 76, 79, 89], "openpow": 60, "openssh": 89, "openssl": [53, 60], "opensus": [28, 30, 31, 32, 33, 34, 38, 41, 46, 47, 49, 51, 60, 63, 67, 68, 69, 77, 78, 83, 87, 89, 91, 92, 93], "opensuse_leap_15": [49, 60], "oper": [1, 4, 16, 18, 20, 23, 30, 36, 37, 38, 41, 42, 43, 45, 46, 51, 60, 61, 62, 63, 64, 65, 69, 75, 80, 84, 90, 93], "opportun": [60, 68, 82], "oppos": 47, "opt": [21, 47], "opt1": 93, "opt2": 93, "optim": 81, "option": [1, 2, 4, 6, 9, 12, 16, 20, 21, 23, 24, 25, 26, 30, 31, 32, 33, 34, 45, 46, 47, 49, 50, 51, 52, 53, 54, 56, 59, 60, 61, 64, 65, 67, 69, 72, 74, 77, 79, 80, 82, 83, 84, 89, 91, 95, 96], "option_str": 60, "option_typ": 1, "optionali": 1, "order": [1, 6, 13, 20, 23, 25, 33, 45, 47, 57, 60, 61, 68, 69, 77, 80, 93], "ordinari": 54, "ore": [1, 20, 60, 68, 86], "org": [28, 29, 30, 31, 34, 38, 41, 46, 49, 56, 60, 62, 63, 68, 77, 87, 91, 93], "organ": [34, 98], "organis": 34, "origin": [25, 30, 41, 43, 54, 60, 68, 80, 82], "orphan": 47, "osc": [34, 54, 77, 78, 79], "osinsid": [38, 54, 63, 68, 69], "osnam": 20, "oss": [31, 34, 68, 93], "other": [1, 4, 11, 16, 20, 21, 23, 28, 30, 31, 32, 34, 36, 45, 46, 47, 48, 51, 52, 54, 55, 57, 58, 59, 60, 61, 62, 63, 64, 65, 67, 68, 70, 71, 73, 75, 77, 80, 81, 84, 85, 86, 87, 88, 89, 93], "otherwis": [1, 12, 16, 23, 36, 41, 43, 46, 49, 51, 54, 58, 65, 77, 89], "our": [1, 23, 58, 73], "out": [1, 9, 28, 30, 31, 34, 38, 46, 52, 54, 60, 61, 63, 69, 70, 84, 93], "outfil": 55, "output": [1, 13, 14, 21, 24, 36, 38, 45, 47, 60, 61, 72, 77, 91, 96], "output_avail": 1, "outsid": [1, 17, 28, 31, 34, 57, 63, 77, 93], "ova": [33, 60], "over": [1, 23, 30, 32, 46, 51, 60, 61, 67, 77, 87, 93, 94, 95], "overal": [23, 80], "overayf": 32, "overhead": [1, 23], "overlai": [1, 6, 9, 11, 23, 28, 45, 46, 47, 51, 60, 64, 65, 77, 81, 86, 93, 95, 97], "overlaid": 32, "overlap": 60, "overlay_mount": 1, "overlayf": [20, 32, 46, 60, 93, 95], "overlayroot": [46, 60], "overlayroot_readonly_parts": 60, "overlayroot_write_partit": 60, "overrid": [12, 21, 26, 60, 96], "overridden": 49, "overview": [27, 60, 61, 62, 77, 90, 91], "overwrit": [1, 20, 21, 39, 41, 43, 45, 46, 47, 60], "overwritten": [1, 4, 14, 20, 40, 45, 65], "ovf": [21, 22, 33], "ovfmanag": 33, "ovftool": [21, 33], "ovftyp": 33, "own": [1, 23, 54, 60, 77, 82, 83, 89, 92], "owner": [1, 2, 60], "ownership": 60, "p": [23, 39, 46, 61, 80, 82, 95, 97], "pack": [45, 60, 61, 63, 64, 79], "packag": [0, 29, 30, 34, 36, 38, 39, 41, 42, 43, 44, 45, 46, 49, 50, 51, 52, 56, 59, 61, 62, 63, 64, 65, 67, 68, 69, 71, 75, 77, 78, 79, 81, 85, 86, 87, 88, 89, 91, 93, 94, 95, 96, 97, 98], "package_gpgcheck": [41, 43, 49], "package_manag": [0, 1, 16], "package_manager_nam": 14, "package_manager_output": 14, "package_matches_host_architectur": 1, "package_nam": [14, 34, 60], "package_request": 14, "package_sect": 1, "package_typ": 1, "package_vers": 34, "packagemanag": [1, 14, 23, 45, 48, 68, 79], "packagemanagerbas": [14, 23], "packagemanagerdnf4": 14, "packagemanagertemplateaptget": 17, "packagemanagerzypp": 14, "packages_sect": 1, "packages_sections_nam": 1, "packer": [22, 89], "pacman": 60, "page": [1, 23, 28, 29, 30, 31, 32, 33, 34, 46, 51, 54, 56, 60, 74, 75, 77, 78, 79, 80, 81, 82, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98], "pair": [1, 23, 28, 41, 43, 67], "panic": 29, "paragraph": 54, "parallel": [54, 77], "param": [1, 19, 23, 51, 54], "param_w_default": 54, "paramet": [1, 2, 4, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 18, 19, 20, 21, 22, 23, 24, 25, 26, 28, 30, 31, 32, 33, 34, 49, 50, 51, 54, 60, 85, 86, 87, 93, 94, 95], "parameter_count": 60, "parametr": 58, "paramt": 60, "parent": [1, 60], "pars": 1, "parser": 1, "part": [1, 4, 7, 19, 23, 24, 28, 31, 38, 39, 41, 43, 45, 46, 47, 49, 51, 54, 56, 57, 60, 61, 62, 64, 65, 67, 68, 72, 80, 82, 86, 93, 96], "part_mapp": 1, "partclon": 80, "partial": 88, "partiali": 88, "particular": 93, "particularli": [30, 72], "partid": 80, "partit": [1, 6, 7, 13, 15, 20, 23, 25, 30, 32, 33, 46, 47, 51, 52, 55, 59, 72, 75, 76, 88, 90, 91, 92, 93], "partition": [0, 1, 20], "partition_id": 15, "partition_nam": [1, 20, 82], "partition_numb": 80, "partition_typ": [1, 20, 82], "partitionerbas": 15, "partitionerdasd": 15, "partitionergpt": 15, "partitionermsdo": 15, "partuuid": 1, "partx": 1, "pass": [1, 6, 22, 23, 26, 30, 32, 33, 41, 43, 46, 47, 51, 54, 60, 93], "pass_or_filenam": [41, 43], "passphras": [1, 20, 60, 67, 88], "passwd": [53, 60], "password": [1, 7, 16, 27, 41, 43, 53, 60, 68, 86, 89], "past": [22, 33], "patch": [23, 39, 61, 71, 81], "path": [4, 6, 7, 9, 10, 11, 12, 13, 14, 16, 19, 20, 21, 23, 24, 25, 26, 29, 34, 37, 38, 41, 42, 43, 44, 46, 51, 53, 55, 57, 58, 60, 61, 68, 77, 79, 82, 86, 88, 89, 92, 93, 98], "path_list": 1, "pattern": [1, 14, 18, 23, 25, 26, 47, 56, 60, 61], "patterntyp": [47, 60], "pc": [1, 68, 96], "pc98": 96, "pci": 29, "peopl": [75, 88], "pep8": 54, "per": [1, 26, 60, 61, 80, 86], "percent": 1, "perform": [1, 23, 24, 30, 41, 42, 43, 45, 46, 47, 49, 51, 54, 58, 67, 71, 75, 83, 93], "period": 54, "perm": 60, "perman": [23, 51, 75], "permiss": [1, 23, 60, 64, 77, 89], "persist": [1, 16, 32, 46, 50, 60, 84], "persistency_typ": [12, 26], "persistent_filesystem": 1, "person": 29, "perspect": 80, "phase": [1, 14, 16, 23, 41, 43, 45, 51, 60, 79], "phone": 86, "physic": [1, 30, 62, 64], "pi": 62, "pick": [23, 45, 46, 68, 77], "pickl": [1, 23], "pid": 1, "piec": 80, "pii": 29, "pilot": 60, "pinch_system": 23, "ping": 79, "pip": [54, 56, 63, 69], "pipe": 23, "pjjj": 67, "pkg_gpgcheck": 16, "place": [6, 14, 16, 23, 46, 47, 59, 60, 63, 68, 69, 77, 82, 93], "placehold": [28, 39, 60, 61, 63, 96], "plain": [6, 23, 53, 60], "plan": [23, 67], "platform": [1, 60, 61], "pleas": [6, 20, 29, 54, 60, 62, 63, 69], "please_work": 22, "plethora": 60, "plu": [9, 16, 26, 30, 31, 45, 60, 61, 65], "plug": [90, 91], "plugin": [1, 18, 54, 57, 58, 62, 63, 67, 68, 71, 73, 74, 89], "plus_packag": [1, 23], "plusrecommend": [47, 60], "plymouth": [23, 46, 60], "pocket": [60, 61], "podman": [28, 52, 58, 60, 68], "poetri": 54, "point": [1, 12, 23, 26, 30, 41, 43, 46, 49, 50, 51, 56, 60, 72, 77, 90, 98], "pointer": [1, 60], "pointless": 75, "polici": [60, 75], "poll": 1, "poll_and_watch": 1, "poll_show_progress": 1, "pool": [1, 18], "popd": 47, "popen": 1, "popul": [20, 45, 47, 51, 81, 93], "popular": 64, "port": [28, 29, 60, 96], "portabl": [23, 32], "posit": [1, 14, 22, 28], "posix": 1, "possibl": [1, 23, 29, 30, 31, 32, 33, 41, 45, 46, 48, 49, 51, 55, 60, 61, 62, 68, 69, 70, 71, 72, 81, 82, 83, 84, 87, 92, 93], "post": [4, 6, 7, 11, 12, 14, 15, 16, 21, 26, 62], "post_bootstrap": [23, 36, 45, 51], "post_init": [4, 6, 7, 11, 12, 14, 15, 16, 21, 26], "post_process_delete_request": 14, "post_process_install_requests_bootstrap": 14, "postfix": 23, "potenti": [47, 80], "power": [30, 86], "powerpc": 60, "powervm": 33, "ppc": [1, 60], "ppc64": [1, 60, 71], "ppc64le": 62, "practic": [70, 98], "pre": [1, 46, 47, 60, 62, 64, 67, 81, 89, 91, 92], "pre_disk_sync": [23, 51], "prebuilt": 79, "precalcul": [12, 20], "preced": [23, 51, 60], "precis": 46, "precondit": 1, "predecessor": 31, "predefin": [38, 46, 47], "prefer": [1, 21, 29, 31, 32, 33, 41, 43, 48, 51, 61, 63, 68, 77, 79, 82, 83, 89], "preferences_matches_host_architectur": 1, "preferlvm": 83, "prefix": [1, 6, 54, 96], "preliminari": 60, "prep": [1, 20, 82], "prepar": [1, 4, 24, 35, 38, 41, 42, 44, 46, 47, 51, 54, 64, 65], "prerequisit": 45, "presenc": 1, "present": [1, 12, 20, 21, 22, 23, 25, 30, 31, 33, 45, 46, 47, 48, 49, 52, 57, 58, 60, 65, 77, 80, 93], "preserv": [1, 23, 68], "preserve_hostnam": 86, "preserve_owner_group": 23, "press": [91, 92], "prevent": [46, 51, 77], "previou": [23, 24, 34, 40, 41, 54, 65], "previous": [9, 19, 30, 42, 44], "primari": [1, 19, 32, 45, 53, 60, 65], "primarili": 60, "print": [22, 23, 36, 38, 51, 54, 56, 57, 60, 72], "print_result": 23, "print_sensit": 23, "prio": 16, "prior": [1, 6, 23, 26, 51, 60, 63, 93], "prioriti": [1, 16, 36, 41, 43, 49, 60], "privat": [1, 54, 60, 62, 98], "prj": 77, "prjconf": [34, 77], "probabl": [63, 77, 80], "problem": [1, 18, 60, 67, 74, 75], "problemat": 71, "proc": 1, "proce": [34, 45, 63], "procedur": [1, 33, 37, 60, 65, 67, 69, 75, 79, 90, 91, 92], "process": [1, 9, 10, 14, 20, 23, 24, 29, 30, 31, 32, 34, 36, 38, 47, 51, 54, 56, 57, 60, 61, 62, 64, 65, 67, 73, 75, 77, 79, 81, 82, 84, 88, 89, 91, 92, 93, 94, 95, 98], "process_delete_request": 14, "process_install_request": 14, "process_install_requests_bootstrap": 14, "process_only_requir": 14, "process_plus_recommend": 14, "processor": 36, "prod": 51, "produc": [60, 61], "product": [1, 14, 33, 51, 59, 76], "product_iso_fil": 98, "product_request": 14, "profil": [1, 4, 29, 36, 38, 39, 45, 47, 49, 55, 59, 61, 64, 72, 76, 77, 89, 93, 97], "profile_1": 78, "profile_2": 78, "profile_a": 60, "profile_b": 60, "profile_fil": 97, "profile_matches_host_architectur": 1, "profile_nam": [23, 60, 78], "program": [1, 13, 38, 46, 47, 60, 81, 93], "program1": 47, "program2": 47, "progress": 1, "project": [1, 13, 23, 34, 46, 49, 54, 56, 60, 63, 67, 73, 79], "project_fil": 1, "prompt": [46, 65, 96], "proper": 60, "properli": [1, 46, 47, 60, 74, 75], "properti": [1, 26, 29], "protect": [1, 20, 29, 60, 75], "protected_map_id": 20, "protocol": [1, 9, 25, 32, 41, 60, 94, 95, 96], "provid": [1, 2, 4, 6, 12, 14, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 33, 34, 35, 36, 38, 39, 41, 43, 45, 46, 47, 48, 49, 50, 52, 53, 54, 55, 56, 57, 60, 61, 62, 63, 64, 65, 66, 67, 68, 71, 73, 74, 75, 76, 77, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98], "provided_data_sector": 60, "provis": 60, "proxi": [29, 96], "proxycommand": 29, "pt": 51, "ptable_entry_typ": [1, 20], "ptuuid": 1, "pub": 54, "public": [1, 54, 62, 67, 89, 98], "publicli": [23, 67], "publish": [1, 34, 60], "pull": [52, 54, 58], "puppet": 47, "purpos": [1, 16, 23, 48, 51, 60, 61, 68, 74, 77, 79, 82, 84, 95], "push": [54, 68], "pushd": 47, "put": [22, 54, 60, 68, 77, 82], "pv": 26, "pvgrub": 33, "pvscsi": 33, "pwdformat": [53, 60], "pxe": [9, 30, 31, 32, 38, 46, 52, 60, 61, 62, 65, 76, 94, 95, 96], "pxe_serv": 30, "pxe_server_ip": 30, "pxeboot": [30, 93], "pxelinux": [30, 93, 94, 95, 96], "py": [7, 13, 56, 58], "pygrub": 33, "pypi": 63, "pytest": [54, 58], "python": [1, 2, 23, 36, 38, 52, 56, 61, 62, 63, 64, 85], "python3": [50, 63, 67, 68], "q": 54, "qcow2": [33, 45, 48, 60, 61, 72], "qemu": [21, 29, 30, 31, 32, 33, 45, 48, 52, 60, 61, 64, 67, 68, 69, 72, 84, 93, 94, 95], "quadruple_token": 24, "qualifi": [1, 6, 60], "quantiti": 60, "question": [72, 84], "queue": 14, "quick": 62, "quickli": 52, "quit": 72, "quot": [6, 23, 54, 93], "quota": [60, 83], "quote_key_value_fil": 23, "quote_titl": 6, "r_ok": 1, "race": 58, "raid": [1, 20, 46, 60, 80, 82], "raid1": [46, 93], "raid_level": 20, "raid_root": 9, "raiddevic": [9, 20], "rais": [1, 9, 12, 13, 14, 16, 18, 19, 20, 21, 23, 26], "raise_on_busi": 1, "raise_on_command_not_found": 1, "raise_on_error": 1, "raise_on_not_found": 23, "ram": [29, 30, 32, 33, 46, 60, 84, 95], "ram1": [84, 93], "ram2": 93, "ramdisk": [30, 32, 60, 76, 93], "ramdisk_s": 84, "ramonli": 60, "rand": 23, "random": [1, 12, 20, 23, 29, 60], "rang": [1, 23, 41, 43, 75, 96], "rare": 60, "raspberri": 62, "rather": 79, "raw": [1, 9, 21, 30, 31, 33, 61, 68, 69, 84], "rawhid": [29, 62, 63], "rc_lang": 60, "rd": [30, 32, 46, 60, 84, 94, 95], "rdinit": 29, "re": [1, 43, 45, 46, 80, 96], "reach": [69, 91], "reachabl": 23, "read": [1, 6, 7, 23, 25, 26, 45, 51, 55, 57, 58, 60, 65, 75, 81, 94, 95], "readabl": [20, 23, 60, 62, 64, 88], "readi": [29, 32, 57, 62, 64], "readonli": [6, 20, 26, 32, 46, 60, 80, 82], "readwrit": 32, "real": [12, 21, 61, 64, 84], "realli": [11, 90], "realnam": 60, "realpath": 1, "reason": [1, 31, 41, 43, 51, 54, 60, 61, 68, 79, 80, 82, 94, 95], "rebase_to_root": 1, "reboot": [14, 29, 30, 32, 46, 60, 65, 75], "reboot_imag": 93, "rebuild": [4, 30, 72, 77, 93], "receiv": [26, 93], "recent": [63, 64], "recogn": 13, "recommend": [14, 18, 30, 41, 43, 45, 46, 47, 51, 52, 53, 54, 57, 60, 63, 64, 71, 73, 89, 92, 93], "reconfig_system": 97, "record": [1, 7], "recoveri": [1, 23, 30, 80], "recreat": 4, "recurs": 1, "recvoeri": 23, "red": [38, 60], "redefin": 60, "redhat": [47, 60], "redirect": [1, 93], "reduc": [1, 60, 67], "refer": [1, 13, 20, 23, 25, 30, 31, 33, 34, 41, 43, 46, 54, 57, 58, 60, 61, 63, 83, 84, 85, 86, 87, 89, 90, 91, 92, 93, 94, 95], "referenc": [4, 51, 60, 79, 80, 82, 88, 89, 93, 96], "reformat": 54, "refresh": 44, "regard": [12, 26, 64, 71], "regist": [1, 21, 46, 62, 67, 68, 85, 86, 87], "registr": 56, "registri": [60, 68], "regular": [45, 47], "rel": [1, 19, 45, 49, 60, 89], "relat": [14, 60], "relaunch": 72, "relax": 56, "relax_justdoit": 56, "relaxjustdoittask": 56, "relaxng": [1, 36], "releas": [1, 41, 43, 47, 51, 61, 62, 63], "release_identifi": 61, "release_result": 61, "release_vers": 14, "relev": [1, 2, 4, 21, 29, 32, 39, 60, 72, 77, 80, 83], "reli": [45, 47, 51, 63, 73], "reload_config": 93, "reload_imag": 93, "remain": [31, 47, 53, 60, 89], "remot": [23, 38, 41, 46, 54, 60, 67, 68, 94, 95], "remov": [1, 16, 23, 32, 44, 45, 51, 60, 77, 89], "remove_hierarchi": 1, "repart": [1, 30, 46, 60], "repartit": 46, "repeat": 94, "replac": [1, 4, 28, 30, 34, 60, 61, 77, 96], "repo": [1, 14, 16, 18, 19, 28, 29, 30, 31, 32, 33, 34, 36, 38, 41, 43, 49, 55, 60, 63, 67, 68, 69, 78, 93, 98], "repo_alia": [1, 55], "repo_fil": [16, 49], "repo_gpgcheck": [1, 16, 41, 43], "repo_imageinclud": 1, "repo_package_gpgcheck": 1, "repo_path": 19, "repo_prio": [1, 55], "repo_signing_kei": 1, "repo_sourc": [1, 19, 55], "repo_typ": [1, 16, 23, 55], "repolist": 49, "report": [1, 18, 51, 52, 60, 74], "repositori": [0, 1, 14, 18, 23, 24, 28, 34, 36, 38, 41, 42, 43, 44, 45, 47, 55, 59, 64, 65, 68, 69, 78, 79, 89, 98], "repository_gpgcheck": [49, 60], "repository_matches_host_architectur": 1, "repository_nam": 77, "repositorybas": [14, 16], "repositorydnf4": 16, "repositoryzypp": 16, "repostori": 16, "repotyp": 77, "repres": [1, 20, 30, 47, 53, 59, 60, 61, 64, 65, 80, 81, 82, 83, 93], "represent": [1, 20, 23, 24, 30, 41, 43, 47, 49], "reproduc": 77, "request": [1, 6, 12, 14, 20, 21, 25, 26, 30, 36, 38, 42, 45, 47, 54, 56, 60, 67, 74, 80, 88, 93], "request_collect": 14, "request_packag": 14, "request_package_exclus": 14, "request_package_lock": 14, "request_product": 14, "requested_filesystem": 23, "requir": [1, 4, 6, 7, 9, 11, 12, 14, 18, 20, 21, 22, 23, 26, 29, 30, 31, 33, 34, 36, 45, 46, 47, 48, 51, 56, 60, 61, 62, 63, 65, 68, 71, 73, 74, 77, 79, 80, 81, 83, 85, 86, 87, 89, 93, 94, 95, 96, 98], "reread": 1, "reserv": [60, 80, 82, 93], "reset": [1, 46, 54, 60, 80], "resid": [1, 49], "resiz": [1, 15, 21, 26, 30, 33, 35, 46, 60, 61, 68, 72, 80, 82, 85, 86, 87, 88, 89], "resize2f": 72, "resize_on_boot": 26, "resize_raw_disk": 21, "resize_t": 15, "resizef": 86, "resizepart": 72, "resolut": [1, 6, 23, 47, 60], "resolv": [1, 36, 57, 73, 77, 79], "resolve_this_path": 1, "resourc": [1, 34, 60, 68, 77, 98], "respect": [45, 60, 63], "respons": [1, 23, 34, 55, 60, 63, 68, 98], "rest": [1, 26, 93], "restart": 92, "restor": 51, "restrict": [60, 75], "restructuredtext": 54, "result": [1, 4, 9, 12, 14, 18, 19, 21, 22, 24, 29, 30, 31, 32, 33, 35, 36, 37, 38, 41, 42, 43, 47, 49, 52, 58, 60, 64, 68, 69, 71, 72, 77, 79, 80, 83, 84, 89, 93], "result_fil": 23, "result_file_typ": 23, "result_inst": 9, "result_name_tag": [1, 23], "result_typ": 23, "resultbundletask": 24, "resultlisttask": 24, "resutl": 61, "ret": 54, "retain": 30, "retri": 30, "retriev": [1, 19, 25], "return": [1, 4, 6, 7, 8, 9, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 36, 46, 54, 56, 60], "returncod": [1, 14], "reus": 55, "review": 54, "revoc": 60, "revok": 90, "rf": 68, "rhel": [18, 47], "right": [51, 54, 56, 60, 61, 63], "riot": 54, "risk": [51, 81], "rm": [28, 51, 58, 68], "rnc": 57, "rng": 57, "ro": [20, 60, 93], "robust": [30, 80], "rollback": 80, "roo": 20, "room": 62, "root": [1, 4, 6, 7, 9, 10, 11, 12, 14, 16, 20, 21, 23, 24, 26, 27, 29, 30, 31, 32, 34, 37, 38, 41, 42, 43, 44, 45, 46, 47, 51, 52, 53, 57, 58, 60, 61, 64, 65, 67, 68, 72, 76, 77, 79, 80, 81, 82, 83, 84, 86, 88, 91, 92, 94, 96, 97, 98], "root_bind": [14, 16], "root_clon": [20, 60, 80], "root_devic": [6, 7], "root_dir": [1, 4, 6, 7, 9, 10, 11, 12, 14, 16, 20, 21, 23, 26], "root_export": 93, "root_hash": 60, "root_path": 1, "root_uuid": 6, "rootbind": [14, 16, 23], "rootdelai": 85, "rootf": [1, 23, 46, 60, 68, 72, 79, 81, 82, 93], "rootflag": 60, "rootfs_label": 60, "rootinit": 23, "rootless": 58, "rootlv": 83, "routin": 62, "rpm": [1, 14, 16, 19, 23, 39, 41, 43, 47, 49, 55, 61, 62, 63, 67, 68, 77, 79], "rpm_dir": 19, "rpm_md": 19, "rpmbuild": 54, "rpmlint": 54, "rsa": [54, 67], "rsa4096": 54, "rst": 54, "rsync": [1, 21, 25, 60, 68, 89], "rsyslog": 86, "rtype": [1, 54], "rubi": 21, "rule": [1, 34, 36, 54, 56, 60, 75, 93], "run": [1, 6, 7, 16, 18, 20, 23, 24, 28, 29, 30, 32, 33, 34, 36, 37, 38, 45, 46, 47, 49, 51, 58, 60, 61, 62, 63, 64, 65, 67, 71, 72, 73, 75, 76, 77, 78, 83, 86, 89, 93, 96, 97], "run_check": 24, "run_common_funct": 23, "run_expect": 58, "run_repo_custom": 16, "runtim": [1, 14, 16, 24, 28, 38, 45, 46, 49, 54, 60, 79], "runtime_config": 16, "runtime_dnf_config": 16, "runtime_dnf_config_fil": 16, "runtime_zypp_config_fil": 16, "runtime_zypper_config": 16, "runtime_zypper_config_fil": 16, "runtimecheck": 1, "runtimeconfig": 1, "rw": [23, 31, 51, 60, 93], "rxmmeasdc035ex": [53, 68], "s390": [1, 6, 60, 62, 71], "s390x": [60, 71], "safe": 47, "safeti": 58, "salt": [53, 60], "same": [1, 9, 14, 16, 21, 23, 25, 26, 29, 30, 32, 33, 38, 39, 40, 41, 43, 45, 46, 47, 48, 49, 51, 60, 61, 67, 68, 73, 74, 77, 79, 90, 93, 94, 95], "saniti": [46, 80], "sat": [1, 19], "satisfi": 77, "satsolv": 19, "save": [29, 30, 31, 32, 57, 77], "sbin": [29, 46], "sc": 54, "scan": [1, 32, 84, 91, 92], "schedul": 1, "schema": [1, 21, 36, 49, 60, 61, 62, 65, 82], "schematron": [1, 36], "schemavers": [29, 32, 33, 47, 48, 49, 53, 60, 68, 77, 78, 79, 83, 89], "scheme": [23, 54], "scope": [6, 14, 23, 38, 46, 55, 60, 61, 84, 94], "scp": [30, 93], "scratch": [21, 28, 77], "screen": [1, 38, 51, 77], "script": [1, 16, 22, 23, 28, 36, 38, 45, 47, 49, 54, 60, 62, 64, 65, 72, 74, 77, 81, 86, 92], "script_exist": 23, "script_path": 16, "scsci": 33, "scsi": [33, 60], "sd": 62, "sda": [46, 93], "sda2": 93, "sdb": 93, "sdk": [33, 87], "sdz1": 91, "search": [1, 13, 23, 24, 37, 50, 60, 77, 79], "search_param": 60, "second": [1, 6, 25, 38, 45, 60, 64, 77, 93, 96], "secret": [16, 19], "secret_set": 22, "section": [1, 23, 30, 33, 34, 41, 43, 45, 46, 47, 51, 54, 60, 61, 65, 77, 82, 97], "section_nam": 1, "section_typ": 1, "sector": [1, 15, 20, 60, 80], "sector_s": 60, "secur": [1, 7, 20, 23, 29, 51, 60, 62, 63, 67, 70, 73, 88], "secure_boot_instal": 7, "securelinux": 1, "security_context_fil": 23, "see": [1, 23, 25, 28, 30, 31, 32, 33, 34, 41, 43, 45, 47, 48, 49, 51, 53, 54, 56, 58, 60, 61, 64, 65, 67, 68, 69, 77, 78, 82, 85, 86, 87, 89, 93, 94, 95], "seek": 1, "select": [1, 23, 30, 36, 38, 41, 43, 45, 46, 47, 49, 52, 58, 59, 60, 61, 62, 64, 68, 69, 77, 78, 90, 91, 92, 93], "self": [7, 45, 54, 56, 66, 73, 74, 75], "selfcontain": 67, "selinux": [23, 60, 75], "selinux_polici": 60, "semant": 54, "semicolon": [41, 43], "send": [1, 38, 93], "sens": 60, "sensit": 29, "sent": [1, 28, 36, 54], "separ": [1, 4, 24, 30, 33, 46, 48, 51, 53, 60, 64, 67, 77, 83, 93], "sequenc": [1, 38, 60, 62, 68, 82, 89], "sequenti": 77, "serial": [1, 8, 30, 31, 32, 60, 69, 84, 85, 87], "serial_lin": 60, "serial_line_setup": 60, "serializ": 21, "seriou": 75, "serv": [1, 30, 46, 60, 79, 84, 93, 96], "server": [1, 9, 30, 47, 60, 76, 77, 94, 95], "servernam": 96, "servic": [1, 11, 23, 34, 36, 37, 38, 39, 40, 41, 42, 43, 44, 46, 47, 49, 51, 54, 56, 60, 62, 63, 64, 67, 68, 73, 75, 76, 79, 86, 88, 89, 96], "service_command": 56, "service_nam": 51, "servicenam": 51, "session": [38, 51], "set": [1, 4, 11, 12, 13, 15, 20, 21, 22, 23, 25, 26, 28, 29, 30, 31, 32, 34, 38, 39, 41, 43, 45, 46, 47, 48, 50, 51, 52, 54, 56, 58, 60, 61, 65, 67, 68, 69, 70, 76, 77, 78, 80, 82, 83, 85, 86, 87, 88, 89, 92, 93, 94, 95], "set_color_format": 1, "set_container_config_tag": 1, "set_custom_runtime_config_fil": 1, "set_derived_from_image_uri": 1, "set_disk_password": 7, "set_dist_typ": 18, "set_flag": 15, "set_hostnam": 86, "set_hybrid_mbr": 15, "set_loader_entri": 6, "set_log_socket": 1, "set_logfil": 1, "set_mbr": 15, "set_media_tag": 13, "set_platform_nam": 1, "set_property_readonly_root": [12, 26], "set_repositori": 1, "set_root_filesystem_uuid": 1, "set_root_partition_uuid": 1, "set_runtime_checker_metadata": 1, "set_selinux_file_context": 23, "set_shared_cache_loc": 1, "set_start_sector": [15, 20], "set_static_modul": 4, "set_temp_loc": 1, "set_uuid": [12, 15], "setenforc": 75, "setlogflag": 1, "setloglevel": 1, "setup": [0, 1, 4, 6, 7, 14, 15, 16, 21, 22, 24, 26, 29, 30, 31, 32, 33, 36, 38, 41, 43, 44, 45, 46, 47, 51, 52, 54, 55, 56, 60, 67, 74, 76, 77, 79, 80, 81, 83, 84, 85, 86, 87, 88, 89, 91, 92, 94, 95, 96, 97], "setup_disk_boot_imag": 6, "setup_disk_image_config": 6, "setup_group": 23, "setup_home_for_us": 23, "setup_install_boot_imag": 6, "setup_install_image_config": 6, "setup_intermediate_config": 23, "setup_keyboard_map": 23, "setup_live_boot_imag": 6, "setup_live_image_config": 6, "setup_load": 6, "setup_local": 23, "setup_machine_id": 23, "setup_media_loader_directori": 13, "setup_mountpoint": 26, "setup_package_database_configur": 16, "setup_permiss": 23, "setup_plymouth_splash": 23, "setup_registry_import": 23, "setup_repositori": 23, "setup_repository_modul": 14, "setup_root_consol": 11, "setup_selinux_file_context": 23, "setup_sysconfig_bootload": 6, "setup_timezon": 23, "setup_us": 23, "setuptool": 56, "setvar": 96, "sever": [33, 49, 51, 52, 60, 65, 73, 75, 82], "sfdisk": 15, "sh": [23, 28, 29, 36, 45, 46, 47, 58, 65, 74, 77, 89, 97], "sha": [24, 39], "sha256": [25, 60], "shadow": 47, "share": [1, 16, 21, 23, 38, 41, 43, 51, 57, 58, 60, 62, 77, 89], "shared_dnf_dir": 16, "shared_loc": [16, 23], "shared_zypper_dir": 16, "shasum": [23, 36], "shebang": 51, "sheet": 1, "shell": [1, 36, 45, 46, 51, 54, 60, 63, 65, 67, 86], "shim": [1, 7, 47, 60, 68], "shim_loader_typ": 1, "shiminstal": 60, "shimopt": 60, "ship": [47, 63, 89, 93], "short": [1, 50, 60, 84], "shorten": 47, "should": [1, 6, 11, 12, 20, 23, 24, 26, 31, 41, 48, 49, 51, 54, 59, 60, 67, 68, 71, 77, 80, 81, 82, 83, 84, 88, 89, 93], "should_perform_task_setup": 24, "show": [1, 30, 33, 34, 38, 46, 51, 55, 56, 60, 62, 67, 77, 90, 91, 92, 93, 98], "show_and_exit_on_help_request": 1, "shown": [1, 25, 29, 30, 31, 32, 33, 46, 47, 51, 60, 71, 80, 82, 94, 95], "shrink": [1, 21], "shutdown": 30, "side": [46, 73, 94, 95], "sig": 28, "sigkil": 28, "sign": [1, 4, 9, 34, 41, 42, 43, 60], "sign_key_a": 60, "sign_key_b": 60, "signal": [1, 28], "signatur": [1, 16, 34, 41, 42, 43, 49], "significantli": 60, "signing_kei": [4, 9, 16, 23, 41, 43], "signingkei": 54, "signkei": 54, "sigterm": [1, 28], "silent": 30, "similar": [14, 30, 36, 57, 65, 67, 75, 93], "similarli": 47, "simpl": [1, 9, 22, 33, 52, 55, 60, 69, 80, 84], "simpler": 77, "simplest": 79, "simpli": [1, 21, 60, 68], "simplifi": [51, 77], "simul": 64, "sinc": [2, 7, 21, 45, 54, 60, 63, 65, 77, 89, 93], "singl": [1, 20, 38, 41, 45, 46, 47, 55, 58, 60, 77], "situat": [46, 47, 70], "size": [1, 12, 15, 20, 21, 22, 26, 30, 36, 37, 46, 54, 74, 80, 82, 83, 84, 85, 86, 87, 89, 93], "size_byt": 21, "size_limit": 23, "size_str": 82, "size_typ": 1, "skip": [7, 14, 18, 23, 30, 60, 84], "skip_miss": 18, "skopeo": 28, "slash": 25, "sle": [47, 51, 63, 98], "sle12": 51, "sled": 60, "slot": 62, "small": [38, 60, 62], "smaller": [1, 23, 30, 47, 60, 80, 82], "smoother": 77, "smp": 72, "snapper": [1, 60], "snapshot": [6, 26, 32, 60, 68, 72, 77], "snip": [29, 32, 33, 47, 49, 78], "snippet": 89, "so": [13, 15, 23, 31, 38, 45, 51, 55, 58, 60, 63, 64, 65, 72, 74, 77, 78, 89, 93], "soc": 62, "socat": 29, "socket": [1, 29, 38, 51], "socketfil": 38, "softwar": [23, 30, 38, 45, 60, 62, 64, 65, 68, 80, 85, 86, 87, 88, 91, 93], "solut": [38, 70], "solv": [1, 18, 36, 74, 75, 77], "solvabl": [1, 16, 18, 19], "solver": [0, 1], "solver_repositori": 18, "solverrepositori": [18, 19], "solverrepositorybas": 19, "solverrepositoryrpmdir": 19, "solverrepositoryrpmmd": 19, "solverrepositorysus": 19, "some": [1, 2, 6, 10, 11, 20, 23, 41, 43, 51, 52, 60, 61, 63, 68, 71, 79, 82, 83, 89, 96], "some1": 60, "some2": 60, "some_data": 25, "somepackag": 77, "somepackage_1": 77, "somepackage_2": 77, "somepakage_1": 77, "someth": 1, "soon": 93, "sort": [1, 26, 61, 62], "sort_by_hierarchi": 1, "sourc": [1, 2, 4, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 30, 36, 38, 41, 43, 47, 49, 51, 54, 58, 62, 65, 68, 77, 79, 80, 89, 92, 93, 98], "source_dir": [2, 13, 23, 25], "source_fil": 25, "source_filenam": 25, "source_provid": 20, "source_typ": 23, "sourcetyp": [16, 60], "space": [1, 20, 26, 30, 33, 37, 41, 43, 46, 60, 64, 72, 80, 82, 83, 84, 89, 93, 96], "spare": [1, 20, 60, 82], "spare_part": [1, 60, 82], "spare_part_f": 60, "spare_part_fs_attribut": 60, "spare_part_is_last": 60, "spare_part_mountpoint": 60, "spars": [21, 74], "spec": [20, 54, 60], "specfi": 1, "special": [1, 4, 6, 7, 11, 12, 13, 14, 15, 16, 19, 20, 21, 22, 23, 25, 26, 38, 46, 47, 49, 54, 60, 83], "specif": [1, 4, 6, 9, 14, 20, 21, 23, 26, 30, 32, 33, 36, 41, 43, 46, 47, 50, 51, 52, 53, 59, 60, 61, 62, 63, 64, 65, 68, 78, 79, 80, 81, 82, 83, 84, 89, 93, 98], "specifi": [1, 6, 9, 12, 19, 20, 21, 23, 24, 25, 26, 28, 29, 30, 31, 32, 34, 36, 37, 38, 39, 41, 42, 43, 44, 45, 46, 47, 49, 51, 53, 57, 58, 59, 60, 61, 62, 64, 77, 80, 82, 83, 84, 89, 93, 94, 95], "speed": [1, 30, 58, 60], "sphinx": 54, "splash": 23, "split": [1, 60], "squashf": [1, 20, 32, 46, 60, 61, 82, 93], "squashfscompress": 60, "squashimg": 46, "src": [47, 93], "srv": [30, 93, 94, 95, 96], "srvip": 93, "ssh": [29, 51, 67, 86, 89], "ssh_svcname": 86, "sshd": [51, 67, 86], "sshf": 67, "ssz": 60, "stabl": [67, 77], "stack": 68, "stackabl": 68, "stackbuild": 68, "stage": [36, 38, 45, 47, 88], "stai": [1, 30, 60, 98], "stand": [34, 68], "standalon": 60, "standalone_integr": 60, "standard": [1, 6, 11, 13, 20, 28, 30, 32, 33, 38, 45, 46, 49, 54, 56, 57, 60, 61, 62, 67, 68, 69, 78, 84], "start": [1, 11, 14, 15, 16, 20, 34, 38, 46, 51, 57, 60, 62, 64, 65, 77, 80, 87, 96, 97, 98], "start_sector": [15, 20], "startup": [34, 56], "state": [1, 4, 23, 60, 61, 80, 86], "stateless": 51, "statement": [1, 59, 60, 77], "static": [1, 4, 7, 9, 10, 11, 12, 13, 14, 15, 16, 19, 20, 21, 22, 23, 26, 36, 60, 77], "staticlink": 77, "staticmethod": 54, "statu": [1, 14, 20, 32, 61, 71], "std": 29, "stderr": 1, "stderr_to_stdout": 1, "stdin": 51, "stdio": [30, 31, 32, 69, 84], "stdout": [1, 38, 55], "step": [21, 23, 24, 30, 38, 41, 42, 43, 46, 47, 51, 60, 62, 63, 64, 65, 68, 72, 75, 78, 79, 89, 92, 94, 95, 96, 98], "stick": [9, 30, 32, 46, 54, 60, 61, 62, 76, 84, 87, 92], "stickdevic": 90, "still": [1, 31, 47, 51, 71, 84, 89], "stop": [45, 46], "stopsign": 28, "storag": [0, 1, 26, 30, 32, 55, 60, 61, 62, 80, 84, 90, 91, 92, 94, 95], "storage_provid": [15, 20], "storagemap": 9, "store": [1, 4, 6, 7, 12, 14, 16, 18, 19, 21, 23, 25, 26, 30, 33, 38, 39, 41, 42, 46, 60, 64, 68, 88, 97], "store_to_result": 21, "str": [1, 4, 6, 7, 9, 10, 11, 12, 13, 14, 15, 16, 19, 20, 21, 22, 23, 24, 25, 26, 54], "strategi": [30, 31, 60, 61, 93], "stream": [1, 14, 60], "streamoptim": 33, "string": [1, 2, 4, 6, 7, 9, 10, 11, 12, 15, 18, 19, 20, 21, 22, 23, 24, 25, 26, 30, 33, 34, 39, 41, 43, 51, 60, 82], "strip": [1, 22], "stripe": [1, 20, 60], "strongli": [77, 92], "structur": [1, 6, 20, 25, 54, 57, 59, 60, 64, 93, 96, 98], "stuff": 57, "style": [1, 15, 25, 60], "stylesheet": [36, 60], "sub": [1, 14, 26, 48, 52, 60], "subclass": [4, 14, 23], "subcommand": [1, 28, 57], "subdir": 96, "subdirectori": [46, 64, 77], "subfold": [54, 77], "subformat": 0, "subject": 77, "submenu": 92, "submit": 54, "subprocess": 1, "subproject": 67, "subscrib": 62, "subsect": [1, 33, 65], "subsequ": 60, "subset": 26, "substep": 45, "substitut": [1, 22, 69], "substr": [1, 61], "substract": 84, "subsystem": [34, 52, 60, 61, 75], "subvol": 60, "subvol_mount_list": 26, "subvolum": [1, 26, 60, 83], "succe": 56, "success": [1, 14, 23, 61, 72, 77, 81], "successfulli": 69, "sudo": [28, 29, 30, 31, 32, 33, 34, 38, 51, 63, 67, 68, 69, 75, 78, 84, 86, 89, 91, 93, 94, 95, 98], "sudoer": 51, "suffici": [45, 60, 89], "suffix": [25, 30, 58, 69, 83], "suggest": [70, 87], "suit": 89, "suitabl": [4, 9, 21, 26, 29, 54, 60, 61, 67, 84, 93], "sum": [23, 24, 30, 80, 93], "superblock": 60, "supplement": 64, "supplementari": [53, 60], "suppli": [1, 21, 28, 32, 51, 60], "support": [1, 2, 4, 6, 7, 8, 9, 12, 14, 15, 16, 20, 21, 23, 25, 26, 29, 30, 32, 33, 34, 38, 41, 43, 45, 46, 47, 50, 51, 52, 53, 54, 57, 60, 61, 62, 63, 64, 65, 67, 68, 71, 73, 78, 79, 80, 81, 82, 83, 84, 88, 89, 91, 92, 93, 94, 95], "supported_zipp": [25, 54], "suppos": 19, "sure": [16, 20, 24, 25, 28, 30, 34, 68, 72, 74, 84, 85, 86, 87, 88, 90, 92, 93, 96], "suse": [1, 18, 19, 33, 34, 41, 46, 47, 51, 60, 68, 76, 77, 85, 86, 87, 88, 93, 97], "suseinsertservic": 51, "suseremoveservic": 51, "suseservic": 51, "susesetupproduct": 51, "susestripkernel": 23, "swap": [1, 20, 30, 82, 84, 87, 93], "swapnam": [1, 30], "swapsiz": [1, 30], "swapspac": 30, "swiss": 62, "switch": [1, 51, 60, 84, 93], "sy": [1, 55], "symbol": 77, "symlink": [23, 51], "sync": [1, 12, 23, 26, 39, 51], "sync_data": [12, 25, 26, 55], "synchron": [51, 60, 89, 93], "synchronis": 1, "synopsi": 78, "syntax": [50, 54, 61], "syscal": 28, "sysconfig": [6, 23, 51, 97], "sysconfig_firsboot": 97, "sysconfig_templ": 97, "syslinux": [91, 96], "syslog_fix_perm": 86, "system": [0, 1, 4, 6, 9, 10, 11, 14, 16, 20, 24, 27, 28, 29, 30, 32, 33, 34, 35, 38, 45, 46, 51, 52, 53, 55, 57, 58, 59, 60, 61, 63, 65, 67, 68, 69, 71, 72, 73, 75, 76, 78, 79, 80, 81, 82, 83, 86, 87, 89, 91, 92, 94, 95, 96, 97], "system_boot": 9, "system_custom_part": 9, "system_efi": 9, "system_info": 86, "system_root_volum": [6, 7], "system_spar": 9, "system_volum": [6, 7], "systembuildtask": 24, "systemcreatetask": 24, "systemctl": [51, 96], "systemd": [6, 7, 11, 20, 23, 46, 51, 60, 79, 83, 87, 88], "systemd_boot": 60, "systemdep": [52, 54], "systemdisk": [1, 30, 83], "systemid": 57, "systemidentifi": [4, 6, 23], "systemprepar": 23, "systempreparetask": 24, "systems": [1, 23, 30, 80, 82], "systemsetup": 23, "systemupdatetask": 24, "systemvg": 26, "sysv": 51, "t": [1, 14, 21, 23, 25, 26, 39, 54, 60, 61, 63, 67, 69, 72, 74, 77, 81, 82, 96], "tab": [67, 77], "tabl": [1, 13, 15, 20, 28, 51, 52, 60, 71, 80, 82, 90, 92, 93], "table_entri": 20, "table_typ": [15, 20], "tag": [1, 13, 21, 28, 41, 43, 60], "tagger": 1, "tagnam": 60, "take": [1, 7, 21, 23, 30, 46, 47, 54, 60, 61, 68, 69, 80, 81, 87, 93], "taken": [1, 6, 16, 20, 21, 26, 34, 46, 51, 60, 61, 64, 68, 75, 77, 80, 98], "tar": [1, 9, 10, 21, 23, 28, 30, 45, 47, 52, 60, 61, 64, 65, 79, 89], "tarbal": [9, 21, 23, 28, 30, 34, 45, 60, 61, 65, 79], "tarfil": 2, "target": [1, 2, 4, 6, 9, 12, 19, 20, 21, 23, 24, 25, 28, 29, 30, 31, 32, 33, 34, 37, 38, 39, 40, 41, 42, 45, 46, 51, 52, 54, 60, 61, 62, 64, 65, 67, 68, 69, 71, 72, 73, 74, 76, 78, 79, 81, 84, 93, 94, 95], "target_arch": [4, 23], "target_blocks": 60, "target_devic": 20, "target_dir": [1, 4, 9, 19, 21, 23, 25, 60], "target_disk": 30, "target_remov": [7, 60], "target_root_dir": 23, "target_st": 1, "target_supports_extended_attribut": 25, "target_typ": 1, "targettyp": 60, "task": [0, 1, 4, 23, 26, 46, 51, 54, 55, 56, 57, 58, 65, 79, 87, 94], "tbz": [9, 52, 60, 61, 79], "tc": 57, "team": [34, 67], "technologi": [29, 32, 60, 61, 62, 64, 67, 89], "tell": [11, 21, 60, 93, 94, 97], "temp": [1, 38], "temp_image_dir": 21, "templat": [0, 1, 6, 9, 54, 60, 86, 93, 97], "templates_dir": 86, "temporari": [1, 4, 6, 21, 23, 25, 30, 38, 41, 45, 60, 75], "temporarli": 23, "tend": [62, 63], "tentuple_token": 24, "term": 46, "termin": [8, 38, 46, 51], "terminal_setup": 60, "terminologi": 31, "test": [1, 27, 28, 29, 30, 31, 32, 33, 38, 51, 56, 57, 60, 61, 62, 63, 67, 68, 69, 72, 77, 78, 84, 89, 93, 94, 95], "test_rmwork": 58, "testinfra": 58, "testing_": 77, "testing_x86": 46, "text": [1, 6, 19, 23, 34, 38, 39, 53, 54, 57, 60, 61, 96], "tftp": [30, 93], "tftp_root_dir": 96, "tftpboot": [30, 93, 94, 95, 96], "tgz": [47, 65], "than": [1, 6, 26, 30, 36, 46, 49, 52, 60, 62, 67, 73, 74, 79, 80, 82], "thank": 54, "thei": [1, 16, 30, 45, 46, 47, 49, 51, 54, 55, 57, 60, 61, 62, 67, 68, 79, 82, 89, 94], "them": [1, 20, 22, 28, 33, 45, 47, 49, 54, 59, 60, 62, 63, 67, 68, 73, 77, 79, 80, 92, 98], "theme": [6, 23], "themselv": [52, 65, 83], "therebi": 77, "therefor": [1, 6, 19, 21, 36, 47, 55, 59, 60, 68, 77, 79, 84, 88, 91, 92, 98], "therfor": 45, "thi": [0, 1, 4, 6, 7, 9, 11, 12, 13, 14, 16, 18, 19, 20, 21, 22, 23, 24, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 38, 39, 40, 41, 42, 43, 45, 46, 47, 48, 49, 51, 52, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 72, 73, 74, 75, 76, 77, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98], "thing": [63, 93], "third": 93, "this_is_soo_insecur": 53, "those": [1, 23, 38, 51, 54, 60, 67, 73, 77, 82, 93, 94], "though": [60, 77, 79], "three": [31, 60, 61, 81], "through": [20, 29, 32, 36, 45, 46, 49, 51, 52, 60, 62, 67, 75, 77, 81, 84, 87, 91, 92, 94, 96, 98], "throughout": 51, "throw": 23, "thrown": 1, "thu": [1, 4, 6, 7, 11, 12, 23, 26, 30, 38, 47, 54, 56, 60, 67, 71, 74, 77, 80, 81, 84, 87, 93], "ti": 82, "tie": 59, "tightli": 60, "time": [1, 6, 9, 11, 12, 19, 20, 23, 24, 26, 30, 33, 38, 40, 41, 42, 43, 44, 46, 47, 50, 54, 56, 59, 60, 61, 67, 68, 70, 74, 80, 81, 82, 86, 90, 91, 92, 94], "timeout": [1, 6, 33, 60, 84, 85, 86, 87, 89, 96], "timeout_styl": [1, 60], "timestamp": 19, "timezon": [23, 51, 65, 68, 86], "titl": [6, 30, 57, 60, 77], "tmp": [10, 19, 28, 29, 30, 31, 32, 33, 34, 38, 55, 60, 67, 68, 69, 78, 93], "tmpf": [1, 46, 60, 93], "tmpfs_mount": 1, "to_profil": 1, "todai": [23, 29, 60, 80], "togeth": [1, 36, 47, 59, 60, 68, 71, 81, 87], "toggl": 60, "token": 19, "told": 72, "too": [16, 20, 26, 46, 47, 60, 64, 77, 93], "tool": [1, 13, 23, 25, 28, 32, 33, 45, 46, 47, 51, 52, 54, 60, 71, 73, 74, 82, 85, 86, 89, 91], "tool_categori": 1, "toolchain": [52, 60, 68, 93], "toolkit": [52, 94], "top": [45, 47, 49, 54, 59, 60, 64, 68, 78, 88], "top_level_entry_profil": 36, "topic": [1, 28, 29, 30, 32, 33, 54, 89], "toplevel": [1, 6, 26, 57, 59, 60], "toplevel_mount": 26, "toplevel_nam": 60, "torito": 1, "total": [1, 33], "touch": [1, 6, 46, 58, 97], "tox": [54, 58], "tpm": 60, "trace": 23, "track": [45, 61], "tradit": 82, "trang": 57, "transact": [18, 96], "transform": [1, 68], "translat": [23, 41, 49, 51, 60], "transpar": 1, "transport": 10, "treat": [1, 14, 60], "tree": [1, 4, 9, 12, 23, 28, 38, 41, 44, 45, 46, 51, 60, 61, 63, 64, 65, 67, 68, 69, 79, 81, 98], "trigger": [9, 23, 31, 32, 51, 60, 83], "trim": 1, "troubl": 69, "troubleshoot": [62, 69, 75], "true": [1, 2, 4, 6, 7, 8, 9, 10, 13, 14, 18, 19, 20, 21, 22, 23, 24, 25, 26, 29, 30, 31, 32, 33, 41, 43, 46, 49, 51, 54, 56, 58, 60, 61, 80, 83, 84, 85, 86, 87, 88, 89], "truncat": 23, "trust": [16, 41, 42, 43, 60, 67], "trust_cpu": 29, "trustworthi": 88, "try": [1, 54, 87], "ttys0": [29, 85, 87], "tumblewe": [31, 34, 46, 58, 62, 63, 68, 77, 93, 95], "tumbleweed_appli": [32, 33], "tune": [45, 65], "tupl": [1, 4, 20, 23, 26], "turn": [15, 20, 54, 60, 61], "tutori": 77, "tux": 10, "tw": 54, "tweak": [70, 71], "twmo": 68, "two": [33, 38, 45, 47, 48, 49, 51, 60, 63, 64, 67, 68, 77, 80, 87, 94, 95], "twogbmaxextentflat": 33, "twogbmaxextentspars": 33, "type": [1, 4, 6, 7, 8, 9, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 29, 30, 31, 32, 33, 34, 36, 38, 39, 41, 42, 43, 45, 46, 47, 48, 49, 51, 52, 54, 59, 62, 65, 67, 68, 72, 74, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 92, 93, 96, 97], "type_identifi": 82, "type_nam": 15, "typecod": 15, "typeddict": [9, 10], "typenam": 60, "typic": [1, 34, 60, 61, 62, 94], "u": [34, 54, 60, 68, 73], "uapi": 1, "ubuntu": [33, 62, 72, 73], "ubuntu64guest": 33, "ud": 1, "udev": 47, "uebn": 67, "uefi": [46, 60, 68, 80, 90, 91, 96], "uh4cgjlkcrabjtjzdek9kvl": 67, "uid": [28, 54], "ultim": 54, "umoci": [1, 28], "umount": [1, 12, 23, 26, 51, 94], "umount_kernel_file_system": 23, "umount_lazi": 1, "umount_volum": [12, 26], "un": 12, "unam": [1, 47, 60], "unattend": [30, 46, 84], "unauthor": 75, "unchang": [30, 60, 75], "uncompress": [1, 2, 21, 24, 25, 39, 60], "uncompressed_filenam": 25, "uncondition": [41, 43], "under": [2, 31, 34, 37, 41, 51, 55, 56, 58, 60, 73, 89], "underlai": [20, 26], "underli": [1, 38, 47], "understand": [46, 60, 61], "understood": 60, "unencrypt": 88, "unexpect": 1, "unfortun": 77, "unicod": 1, "unifi": 20, "uniniti": [23, 51], "uninstal": [1, 23, 45, 60], "union": [1, 93], "unionfs_config": 93, "unionfs_configur": 93, "uniqu": [1, 41, 43, 51, 57, 60, 80, 82], "unit": [1, 12, 23, 33, 46, 51, 60, 80, 82, 85, 86, 87, 89], "unit_py3_11": 54, "unit_typ": 1, "univers": 31, "unix": [1, 30, 38, 53, 60, 90, 91], "unknown": [1, 23, 54, 81], "unless": [1, 14, 20, 51, 54, 60], "unlock": 20, "unmount": [1, 26], "unpack": [23, 30, 45, 51, 60, 64, 65, 79], "unpackag": 45, "unpartit": [1, 9, 33, 46, 80, 82], "unplug": 84, "unpredict": [60, 77], "unreason": 52, "unresolv": [60, 77], "unsaf": 1, "unsign": [1, 28], "unspecifi": 1, "unstabl": 30, "unsuit": 50, "unsupport": 1, "until": [1, 60], "untouch": [1, 34, 91, 92], "unus": [4, 6, 7, 11, 12, 13, 14, 15, 16, 21, 26, 33], "unwant": [16, 21, 45, 46, 82], "up": [1, 6, 11, 19, 23, 30, 43, 45, 46, 47, 54, 56, 57, 60, 63, 64, 65, 72, 76, 77, 89, 93, 94, 95], "updat": [4, 6, 9, 14, 23, 24, 30, 35, 36, 51, 54, 60, 62, 63, 67, 76, 77, 80, 85, 86, 87, 88, 89, 97], "update_etc_host": 86, "update_hostnam": 86, "update_system": 23, "upgrad": [1, 24, 62, 86], "upload": [77, 85, 86, 87], "upon": 65, "uppercas": 96, "upstream": [32, 60, 72, 73, 91, 92], "uri": [1, 16, 19, 30, 41, 43, 46, 57, 60], "uri_list": 23, "uri_typ": 43, "url": [1, 23, 30, 41, 43, 49, 60, 63, 77], "urllib": 1, "urlopen": 1, "urn": 57, "us": [1, 2, 4, 6, 9, 10, 12, 13, 14, 16, 18, 19, 20, 21, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 36, 37, 38, 39, 41, 42, 43, 44, 45, 46, 47, 48, 49, 51, 52, 53, 54, 56, 58, 59, 60, 61, 63, 64, 65, 67, 68, 69, 71, 72, 73, 74, 76, 78, 79, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97], "usabl": [32, 68, 77], "usag": [1, 22, 45, 48, 56, 60, 89], "usb": [30, 32, 46, 60, 61, 62, 76, 84, 92], "use_default_loc": 16, "use_for_bootstrap": 60, "use_for_bundl": 23, "user": [1, 10, 16, 19, 21, 28, 30, 41, 43, 45, 47, 49, 52, 54, 55, 58, 63, 64, 65, 67, 68, 75, 77, 82, 86, 89, 90, 91, 93, 95, 96, 98], "user_add": 23, "user_credenti": 1, "user_exist": 23, "user_modifi": 23, "user_nam": [1, 23], "useradd": 23, "usermod": 23, "usernam": [16, 53, 54, 60], "userspac": 60, "usr": [1, 46, 47, 57, 60, 62, 83], "usrmerg": 79, "usual": [1, 9, 18, 36, 45, 46, 51, 54, 60, 64, 65, 68, 77, 79, 81, 84, 89, 91, 96, 98], "utc": 68, "utf": [1, 60, 68, 77, 78, 89], "utf8": 23, "util": [0, 34, 54, 58, 60, 62, 72, 79, 96, 97], "uuid": [1, 6, 12, 15, 20, 25, 26, 30, 31, 46, 51, 60, 80, 82, 85], "uuid4": [23, 41, 43, 49], "uwp": 34, "v": [23, 38, 39, 60, 61, 70, 73, 85], "v2": 2, "v247": 23, "v249": 51, "v74": 62, "v9": 60, "vagrant": [1, 21, 22, 33, 51, 60, 62, 76, 77, 78], "vagrant_post_init": 21, "vagrantconfig": [1, 21, 89], "vagrantconfigtempl": [21, 22], "vagrantfil": [21, 22], "vagrantup": 21, "valid": [1, 16, 23, 24, 32, 33, 34, 36, 40, 41, 42, 43, 49, 51, 52, 54, 57, 60, 65, 67, 68, 81, 83], "valu": [1, 10, 12, 19, 20, 21, 22, 23, 24, 28, 30, 32, 33, 36, 37, 38, 41, 43, 46, 47, 49, 51, 60, 61, 75, 80, 82, 83, 84, 88, 93], "valueerror": 1, "var": [1, 10, 19, 38, 51, 60, 79, 82, 86, 97], "vari": [6, 65], "variabl": [1, 21, 22, 23, 28, 30, 36, 46, 54, 58, 60], "variant": [23, 25, 58, 81], "variat": 60, "varieti": 93, "variou": [23, 34, 61, 62], "vblade": [93, 94, 95], "vboxf": 89, "vboxsf": 89, "vcehlsns1d50wnfoaiprgddy04omiaj8": 67, "vda3": 72, "vdi": [33, 60], "vendor": [1, 30, 73, 89, 98], "veri": [54, 60, 75, 77, 80, 90], "verif": [1, 12, 23, 26, 30, 32, 60, 61, 84], "verifi": [1, 13, 23, 30, 33, 49, 58, 60, 61, 84, 89], "verification_metadata_signing_key_fil": 1, "verify_image_s": 23, "veriti": 60, "verity_block": 60, "veritysetup": [12, 26, 60], "version": [14, 23, 33, 34, 35, 38, 39, 41, 43, 48, 51, 55, 57, 59, 61, 62, 63, 64, 65, 66, 68, 69, 73, 74, 77, 78, 79, 89, 93, 94, 95], "vesa": [1, 6], "vgroup": 83, "vh4vw1n4alxkq": 89, "vhd": [33, 60, 85], "vhdfixedtag": 60, "vhdx": [33, 60], "vhost4": 29, "vi": [29, 46, 68, 93, 95], "via": [1, 9, 12, 21, 22, 23, 26, 29, 30, 32, 33, 34, 38, 41, 43, 45, 47, 48, 49, 50, 51, 53, 54, 58, 60, 61, 62, 63, 69, 77, 78, 79, 80, 81, 82, 83, 89, 93, 94, 95, 96], "video": 1, "video_typ": 1, "vim": [33, 54], "virtio": [31, 33, 67, 69], "virtiof": 67, "virtual": [21, 22, 27, 28, 30, 34, 38, 45, 46, 48, 49, 51, 52, 56, 60, 61, 62, 63, 64, 65, 67, 68, 69, 77, 84, 85, 86, 87, 88, 89, 93, 94], "virtualbox": [21, 22, 64, 89], "virtualbox_guest_additions_pres": [1, 89], "virtualboxovftempl": [21, 22], "virtualenv": 54, "virtuals": 89, "visibl": [47, 49, 77, 80, 95], "visit": [29, 46], "vm": [22, 48, 67, 71, 72, 89], "vm_descript": 22, "vm_name": 22, "vmconfig": [1, 33], "vmconfig_entri": 1, "vmdisk": [1, 33], "vmdk": [33, 48, 60], "vmdvd": [1, 33], "vmnic": [1, 33], "vmware": [21, 22, 33, 48], "vmwaresettingstempl": 22, "vmx": 33, "volid": [41, 43, 60], "volum": [1, 6, 7, 9, 10, 12, 26, 28, 30, 60, 76, 82], "volume_group": 26, "volume_group_nam": 26, "volume_label": 1, "volume_manag": 0, "volume_manager_inst": 6, "volume_map": 26, "volume_matches_host_architectur": 1, "volume_nam": 1, "volume_par": 1, "volume_s": 1, "volume_typ": [1, 26], "volumemanag": [12, 26], "volumemanagerbas": [9, 26], "volumemanagerbtrf": 26, "volumemanagerlvm": 26, "vsock": 29, "vtoc": 20, "w_ok": 1, "wa": [1, 16, 22, 26, 31, 43, 45, 56, 59, 67, 72, 79, 84, 90, 91, 94, 95], "wai": [1, 23, 26, 31, 32, 36, 41, 43, 45, 49, 51, 54, 55, 60, 61, 62, 63, 72, 73, 75, 77, 79, 81, 82, 89, 93, 97], "wait": [1, 30], "want": [1, 21, 47, 54, 55, 56, 60, 63, 67, 72, 75, 78, 89], "warn": [1, 23, 38], "warningfilt": 1, "wast": [1, 20], "we": [1, 6, 14, 20, 21, 23, 27, 30, 41, 43, 47, 54, 56, 57, 60, 61, 64, 67, 69, 71, 72, 73, 74, 77, 87, 89, 93], "web": [1, 60, 62, 77], "welcom": 67, "well": [1, 20, 30, 31, 32, 46, 52, 57, 60, 62, 64, 67, 71, 77, 84], "were": [1, 51, 59, 61, 68, 81, 87], "what": [23, 54, 60, 97], "whatev": 60, "when": [1, 16, 21, 23, 28, 30, 31, 32, 33, 34, 36, 41, 45, 46, 47, 48, 51, 53, 54, 60, 61, 63, 64, 67, 68, 71, 72, 74, 75, 77, 79, 80, 81, 82, 83, 87, 88, 89, 93, 96, 98], "whenev": 51, "where": [1, 33, 47, 49, 54, 59, 61, 67, 72, 77, 79, 81, 84, 93], "wherea": [32, 54], "whether": [1, 30, 32, 33, 34, 47, 48, 49, 51, 54, 55, 60, 63, 80, 89, 92], "which": [1, 4, 6, 9, 11, 12, 14, 16, 18, 20, 21, 23, 24, 26, 28, 29, 30, 31, 33, 36, 41, 43, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 59, 60, 61, 62, 63, 65, 66, 67, 68, 69, 70, 71, 73, 74, 75, 76, 77, 79, 80, 81, 82, 83, 84, 85, 86, 87, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98], "whichev": 54, "while": [1, 20, 30, 32, 41, 43, 46, 51, 60, 72], "who": [63, 75], "whole": 60, "whose": [18, 47, 80], "whther": 31, "why": [60, 68], "wide": [23, 75], "width": 54, "wiki": [30, 93], "wikibook": [30, 93], "window": [1, 34, 52, 60, 61, 91, 92], "wipe": [1, 20], "wire": 89, "wise": [1, 60, 82], "wish": [60, 69], "with_timeout": 8, "within": [1, 29, 33, 60, 61, 64, 65, 72, 76, 87, 94, 95, 96], "without": [1, 22, 23, 30, 45, 46, 47, 49, 60, 61, 65, 67, 68, 77, 78, 79, 80, 82, 84, 89, 90, 92], "won": 63, "word": [60, 61], "work": [15, 20, 23, 28, 33, 38, 41, 42, 43, 45, 47, 51, 54, 60, 61, 62, 63, 67, 68, 69, 71, 73, 75, 82, 84, 89, 90, 92, 96], "workaround": 77, "workdir": 28, "worker": [1, 34], "workflow": [30, 33, 46, 62, 64], "working_directori": 23, "working_with_kiwi": 54, "workingdir": [10, 28], "workload": 1, "worksheet": 76, "world": 68, "worth": 71, "would": [1, 21, 54, 60, 61, 71, 75, 77, 79, 80, 81, 84, 87, 92], "wrapper": 13, "writabl": [32, 51, 60], "write": [1, 4, 6, 12, 23, 25, 26, 32, 38, 41, 46, 51, 54, 60, 75, 80, 83, 86, 93, 95], "write_devic": 6, "write_meta_data": 6, "write_system_config_fil": 4, "write_to_disk": 23, "written": [32, 46, 54, 56, 58, 60, 96, 97], "wrong": 1, "wrongli": 81, "wsl": [1, 27, 52, 60, 61], "wto": 33, "www": [21, 33, 57], "wyjugpm5": [53, 68], "x": [10, 12, 54, 93], "x11": 89, "x86": [1, 28, 29, 30, 31, 32, 33, 34, 38, 47, 60, 62, 67, 68, 69, 71, 77, 78, 93, 95, 96], "x86_64": [1, 28, 29, 30, 32, 33, 47, 61, 68, 69, 71, 72, 77, 79, 84, 86, 90, 91, 93, 94, 95], "x86pc": 96, "x_ok": 1, "xdist": 54, "xdm6wwzqhae": 67, "xen": [1, 6, 8, 23, 33, 60, 86], "xen_hypervisor_typ": 23, "xen_load": [1, 33, 86], "xf": [9, 30, 32, 60, 61, 68, 74, 80, 82], "xfs_info": 74, "xkb": 60, "xml": [1, 4, 20, 23, 24, 28, 29, 31, 32, 33, 34, 36, 38, 41, 43, 44, 45, 51, 52, 55, 59, 60, 62, 64, 65, 68, 77, 78, 83, 88, 89, 93, 97], "xml_": 41, "xml_data": [1, 55], "xml_descript": [55, 57], "xml_pars": [1, 21], "xml_state": [4, 6, 7, 9, 12, 20, 21, 23, 55], "xmlcatalog": 57, "xmldescript": [1, 55, 57], "xmln": 57, "xmlstate": [1, 4, 6, 7, 9, 12, 20, 21, 23, 26, 55], "xorriso": 1, "xscale_efi": 96, "xsl": 62, "xsl_to_v74": 62, "xslt": [1, 36, 60], "xsltproc": 62, "xvc0": 86, "xxx": 98, "xyz": [53, 60], "xz": [1, 2, 9, 24, 25, 28, 30, 39, 60, 61, 79], "xz_option": [2, 9], "y": 20, "yaml": [1, 36, 50, 52], "yast": 76, "yast2": 97, "ye": [51, 71], "year": 54, "yellow": 38, "yet": [1, 7, 60, 63, 67, 79], "yml": [1, 38, 50], "you": [22, 23, 28, 29, 30, 31, 32, 33, 34, 38, 40, 43, 45, 46, 47, 48, 49, 51, 54, 55, 56, 57, 58, 60, 62, 63, 64, 65, 67, 68, 72, 77, 78, 89, 92, 93, 96], "your": [20, 21, 22, 28, 29, 30, 32, 33, 34, 45, 49, 53, 54, 55, 56, 57, 58, 62, 63, 72, 74, 77, 78, 79, 80, 86, 89, 90, 91, 92, 93, 96, 97], "your_email": 54, "your_password": 53, "your_sign_key_id": 54, "yourself": 77, "ytxphhuhhgaieubuher2gzoo": 67, "z": 60, "z0": 60, "za": 60, "zap": 20, "zero": [1, 15, 51, 54], "zfcp": 60, "zip": [21, 34], "zipl": [1, 60], "zipl2grub": 6, "zone": 60, "zoneinfo": 60, "zstd": 60, "zsync": 39, "zsync_sourc": 39, "zvm": 33, "zypp": 16, "zypper": [28, 34, 45, 47, 48, 49, 60, 63, 67, 68, 94], "zypper_arg": [14, 16]}, "titles": ["Python API", "kiwi Package", "kiwi.archive Package", "kiwi.boot Package", "kiwi.boot.image Package", "kiwi.bootloader Package", "kiwi.bootloader.config Package", "kiwi.bootloader.install Package", "kiwi.bootloader.template Package", "kiwi.builder Package", "kiwi.container Package", "kiwi.container.setup Package", "kiwi.filesystem Package", "kiwi.iso_tools Package", "kiwi.package_manager Package", "kiwi.partitioner Package", "kiwi.repository Package", "kiwi.repository.template Package", "kiwi.solver Package", "kiwi.solver.repository Package", "kiwi.storage Package", "kiwi.storage.subformat Package", "kiwi.storage.subformat.template Package", "kiwi.system Package", "kiwi.tasks package", "kiwi.utils Package", "kiwi.volume_manager Package", "Building Images for Supported Types", "Build a Container Image", "Build an AWS Nitro Enclave", "Build an Expandable Disk Image", "Build KIS Image (Kernel, Initrd, System)", "Build an ISO Hybrid Live Image", "Build a Virtual Disk Image", "Build a WSL Container Image", "Working from the Command Line", "kiwi-ng image info", "kiwi-ng image resize", "kiwi-ng", "kiwi-ng result bundle", "kiwi-ng result list", "kiwi-ng system build", "kiwi-ng system create", "kiwi-ng system prepare", "kiwi-ng system update", "Concept and Workflow", "Customizing the Boot Process", "Adding and Removing Packages", "Image Profiles", "Setting up Repositories", "The Runtime Configuration File", "User-Defined Scripts", "Host Requirements To Build Images", "Adding Users", "Contributing", "Using KIWI NG in a Python Project", "Plugin Architecture", "Extending KIWI NG with Custom Operations", "Write Integration Tests for the Scripts", "Image Description", "Image Description Elements", "Image Types", "Building Linux System Appliances", "Installation", "Overview", "Basic Workflow", "KIWI Plugins", "Building in a Self-Contained Environment", "Building based on Containers", "Quick Start", "Troubleshooting", "Architectures", "Boxbuild Tweaks", "Build Host Constraints", "Incompatible Filesystem Settings on Host vs. Image", "Host Security Settings Conflicts with KIWI", "Working with Images", "Building in the Open Build Service", "Building Images with Profiles", "Circumvent Debian Bootstrap", "Partition Clones", "Add or Update the Fstab File", "Custom Disk Partitions", "Custom Disk Volumes", "Deploy and Run System in a RamDisk", "Image Description for Microsoft Azure", "Image Description for Amazon EC2", "Image Description for Google Compute Engine", "Image Description Encrypted Disk", "Image Description for Vagrant", "Deploy ISO Image on an USB Stick", "Deploy ISO Image as File on a FAT32 Formated USB Stick", "Booting a Live ISO Images from Grub2", "Build PXE Root File System Image for the legacy netboot infrastructure", "Booting a Live ISO Image from Network", "Booting a Root Filesystem from Network", "Setting Up a Network Boot Server", "Setting Up YaST at First Boot", "Using SUSE Product ISO To Build"], "titleterms": {"": 93, "The": [45, 47, 50, 54, 57, 62], "To": [52, 98], "abstract": [28, 29, 30, 31, 32, 33, 34, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98], "ad": [33, 47, 49, 53], "add": 81, "addit": 54, "advantag": 77, "after": 93, "amazon": 86, "an": [29, 30, 32, 65, 90], "api": 0, "app": 1, "applianc": [62, 63], "apt": 17, "architectur": [56, 71], "archiv": [2, 9, 47, 60], "aw": 29, "azur": 85, "backend": 67, "base": [4, 6, 7, 11, 12, 13, 14, 15, 16, 19, 21, 24, 26, 68], "basic": [54, 65], "befor": 69, "between": 77, "block": 25, "boot": [3, 4, 46, 92, 93, 94, 95, 96, 97], "bootload": [5, 6, 7, 8, 33, 60], "bootloaderset": 60, "bootsplash": 60, "bootstrap": 79, "bootstrap_packag": 79, "box": 72, "boxbuild": [67, 72], "branch": 54, "btrf": [12, 26], "bugfix": 54, "build": [27, 28, 29, 30, 31, 32, 33, 34, 41, 45, 52, 62, 67, 68, 69, 72, 73, 77, 78, 93, 98], "builder": 9, "builtin_kiwi": 4, "bump": 54, "bundl": [39, 61], "case": [62, 80], "catalog": 57, "cd": [30, 33], "check": 60, "checksum": 25, "choos": 69, "circumv": 79, "cli": 1, "client": 93, "clone": [54, 80], "clone_devic": 20, "code": 54, "collectionmodul": 60, "command": [1, 35, 67], "command_process": 1, "compon": 65, "compress": 25, "comput": 87, "concept": [45, 62, 68], "conceptu": 64, "config": [6, 51], "configur": [33, 50, 51, 77, 93, 96], "conflict": 75, "constraint": 73, "contact": 62, "contain": [9, 10, 11, 28, 34, 60, 67, 68], "containerconfig": 60, "content": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 59], "contribut": 54, "control": 33, "convent": 56, "cpio": 2, "creat": [42, 45, 54, 68, 79], "custom": [30, 33, 46, 57, 69, 82, 83, 89, 93], "dasd": 15, "debian": 79, "debug": [46, 51], "default": 1, "defin": 51, "deploi": [84, 90, 91], "deploy": [30, 93], "descript": [36, 37, 38, 39, 40, 41, 42, 43, 44, 59, 60, 63, 65, 85, 86, 87, 88, 89], "develop": [51, 54], "device_provid": 20, "dhcp": 96, "differ": [77, 93], "directli": 33, "disk": [9, 20, 30, 33, 82, 83, 88, 93], "distribut": 63, "distro": 71, "distrolaunch": 34, "dmsquash": 32, "dnf4": [14, 16], "dnsmasq": 96, "docker": 11, "document": [32, 54], "download": 93, "dracut": 4, "drive": 33, "dvd": [30, 33], "each": 54, "ec2": 86, "element": [47, 60], "embed": 89, "enclav": 29, "encrypt": 88, "engin": 87, "enterpris": 63, "environ": [51, 54, 67], "exampl": [38, 56, 63], "except": 1, "excludedoc": 60, "expand": 30, "ext2": 12, "ext3": 12, "ext4": 12, "extend": 57, "extens": 57, "fat16": 12, "fat32": [12, 91], "featur": 54, "file": [50, 60, 81, 91, 93], "filesystem": [9, 12, 74, 95], "filter": 60, "firmwar": 1, "first": [69, 97], "forc": 93, "fork": 54, "format": [61, 91], "from": [35, 63, 68, 92, 94, 95], "fstab": 81, "function": 51, "gce": 21, "git": 54, "global": 38, "googl": 87, "gpt": 15, "grub2": [6, 7, 8, 92], "help": 1, "hook": 46, "host": [52, 73, 74, 75], "how": 79, "hybrid": 32, "ident": 59, "identifi": 23, "ignor": [47, 60], "imag": [4, 27, 28, 30, 31, 32, 33, 34, 36, 37, 45, 46, 48, 51, 52, 59, 60, 61, 65, 68, 69, 72, 74, 76, 78, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94], "includ": [59, 60], "incompat": 74, "increas": 72, "info": 36, "inform": 54, "infrastructur": 93, "initrd": 31, "instal": [7, 9, 30, 54, 63, 68, 96], "installmedia": 60, "integr": 58, "interfac": 33, "iso": [13, 32, 90, 91, 92, 94, 98], "iso_tool": 13, "isof": 12, "kernel": [23, 31, 93], "keytabl": 60, "ki": [9, 31], "kiwi": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 36, 37, 38, 39, 40, 41, 42, 43, 44, 51, 55, 57, 66, 75], "legaci": 93, "line": 35, "link": 62, "linux": [62, 63], "list": 40, "live": [9, 32, 92, 94], "load": 93, "local": [54, 60, 77, 78, 93], "logger": 1, "logger_color_formatt": 1, "logger_filt": 1, "loop_devic": 20, "luks_devic": 20, "luksformat": 60, "lvm": 26, "machin": [33, 60], "main": 59, "manual": 30, "mapped_devic": 20, "md": 93, "media": 30, "method": 30, "microsoft": 85, "modifi": 33, "modul": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26], "mount_manag": 1, "msdo": 15, "name": 56, "namedcollect": [47, 60], "namespac": 59, "netboot": 93, "network": [30, 33, 94, 95, 96], "ng": [36, 37, 38, 39, 40, 41, 42, 43, 44, 51, 55, 57], "nitro": 29, "ob": [63, 77], "oci": 10, "oem": 30, "oemconfig": 60, "open": [77, 78], "oper": [54, 57], "option": [36, 37, 38, 39, 40, 41, 42, 43, 44, 93], "ova": 21, "overlai": 32, "overview": [45, 64], "packag": [1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 47, 54, 60], "package_manag": 14, "packagemanag": 60, "paramet": 46, "partit": [60, 80, 82], "partition": 15, "patch": 54, "path": [1, 49], "plugin": [56, 66], "prefer": [59, 60], "prepar": [23, 43, 45], "privileg": 1, "process": [45, 46], "product": [47, 60, 98], "profil": [23, 48, 51, 60, 78], "project": [55, 77], "protocol": 93, "provid": 51, "pxe": 93, "python": [0, 54, 55], "qcow2": 21, "quick": 69, "raid": 93, "raid_devic": 20, "ramdisk": 84, "reboot": 93, "rebuild": 68, "recommend": 77, "relax": 57, "releas": 60, "reload": 93, "remot": 93, "remov": 47, "repositori": [16, 17, 19, 49, 54, 60, 63, 77], "requir": [52, 54, 64, 67], "resiz": 37, "result": [23, 39, 40, 61], "result_bundl": 24, "result_list": 24, "root": [59, 93, 95], "root_bind": 23, "root_init": 23, "rpm": [54, 60], "run": [54, 69, 84], "runtim": 50, "runtime_check": 1, "runtime_config": 1, "sat": 18, "schema": 57, "script": [46, 51, 58], "section": 57, "secur": 75, "securelinux": 60, "self": 67, "server": [93, 96], "servic": [77, 78], "set": [33, 49, 74, 75, 96, 97], "setup": [11, 12, 20, 23, 34, 58, 59, 93], "sh": 51, "share": 67, "shell": 23, "sign": 54, "signatur": 60, "size": [23, 33, 60, 72], "softwar": 59, "solver": [18, 19], "sourc": [59, 60], "specifi": 33, "squashf": 12, "start": 69, "stash": 68, "step": 45, "stick": [90, 91], "storag": [20, 21, 22], "style": 54, "subformat": [21, 22], "submodul": [1, 2, 4, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26], "support": [27, 49], "suse": [63, 98], "sync": 25, "synopsi": [36, 37, 38, 39, 40, 41, 42, 43, 44], "sysconfig": 25, "system": [23, 31, 41, 42, 43, 44, 47, 54, 62, 64, 84, 93], "system_build": 24, "system_cr": 24, "system_prepar": 24, "system_upd": 24, "systemd_boot": [6, 7], "systemdisk": 60, "tar": 2, "task": 24, "templat": [8, 17, 22, 51], "terminologi": 64, "test": [34, 54, 58], "tftp": 96, "theme": 60, "timeout": 93, "timezon": 60, "tip": 51, "troubleshoot": 70, "turn": 68, "tweak": [69, 72], "type": [27, 60, 61], "uninstal": 47, "unit": 54, "up": [33, 49, 96, 97], "updat": [44, 81], "upstream": 54, "uri": 23, "uri_typ": 41, "us": [55, 57, 62, 77, 80, 98], "usb": [90, 91], "user": [23, 51, 53, 59, 60], "util": 25, "v": 74, "vagrant": 89, "vagrant_bas": 21, "vagrant_config": 22, "vagrant_libvirt": 21, "vagrant_virtualbox": 21, "vagrantconfig": 60, "vagrantfil": 89, "variabl": 51, "vdi": 21, "version": [1, 54, 60], "vhd": 21, "vhdfix": 21, "vhdx": 21, "virtual": [33, 54], "virtualbox_ovf": 22, "vm": [33, 68], "vmdk": 21, "vmware_set": 22, "volum": 83, "volume_manag": 26, "work": [35, 76, 77], "workflow": [45, 65], "write": 58, "wsl": 34, "xf": 12, "xml": 57, "xml_descript": 1, "xml_state": 1, "xorriso": 13, "yast": 97, "you": 69, "your": 69, "zipl": [6, 7], "zypper": [14, 16]}}) \ No newline at end of file diff --git a/troubleshooting.html b/troubleshooting.html index 23de86ba0c4..d88ee678712 100644 --- a/troubleshooting.html +++ b/troubleshooting.html @@ -6,14 +6,14 @@ - Troubleshooting — KIWI NG 10.2.1 documentation + Troubleshooting — KIWI NG 10.2.2 documentation - + diff --git a/troubleshooting/architectures.html b/troubleshooting/architectures.html index a8d73aa271c..cd8db32bbe8 100644 --- a/troubleshooting/architectures.html +++ b/troubleshooting/architectures.html @@ -6,14 +6,14 @@ - Architectures — KIWI NG 10.2.1 documentation + Architectures — KIWI NG 10.2.2 documentation - + diff --git a/troubleshooting/boxbuild_tweaks.html b/troubleshooting/boxbuild_tweaks.html index d273637c437..25fe2d06b26 100644 --- a/troubleshooting/boxbuild_tweaks.html +++ b/troubleshooting/boxbuild_tweaks.html @@ -6,14 +6,14 @@ - Boxbuild Tweaks — KIWI NG 10.2.1 documentation + Boxbuild Tweaks — KIWI NG 10.2.2 documentation - + diff --git a/troubleshooting/buildhost_constraints.html b/troubleshooting/buildhost_constraints.html index 90b00dcf75a..49edfa56023 100644 --- a/troubleshooting/buildhost_constraints.html +++ b/troubleshooting/buildhost_constraints.html @@ -6,14 +6,14 @@ - Build Host Constraints — KIWI NG 10.2.1 documentation + Build Host Constraints — KIWI NG 10.2.2 documentation - + diff --git a/troubleshooting/filesystems.html b/troubleshooting/filesystems.html index 10984ae241b..e0f39ed9b23 100644 --- a/troubleshooting/filesystems.html +++ b/troubleshooting/filesystems.html @@ -6,14 +6,14 @@ - Incompatible Filesystem Settings on Host vs. Image — KIWI NG 10.2.1 documentation + Incompatible Filesystem Settings on Host vs. Image — KIWI NG 10.2.2 documentation - + diff --git a/troubleshooting/security.html b/troubleshooting/security.html index 8b11c32361a..3d7f75db057 100644 --- a/troubleshooting/security.html +++ b/troubleshooting/security.html @@ -6,14 +6,14 @@ - Host Security Settings Conflicts with KIWI — KIWI NG 10.2.1 documentation + Host Security Settings Conflicts with KIWI — KIWI NG 10.2.2 documentation - + diff --git a/working_with_images.html b/working_with_images.html index 13e2f9d212d..b9c9b71d305 100644 --- a/working_with_images.html +++ b/working_with_images.html @@ -6,14 +6,14 @@ - Working with Images — KIWI NG 10.2.1 documentation + Working with Images — KIWI NG 10.2.2 documentation - + diff --git a/working_with_images/build_in_buildservice.html b/working_with_images/build_in_buildservice.html index 599d16b65b6..fea3992c09e 100644 --- a/working_with_images/build_in_buildservice.html +++ b/working_with_images/build_in_buildservice.html @@ -6,14 +6,14 @@ - Building in the Open Build Service — KIWI NG 10.2.1 documentation + Building in the Open Build Service — KIWI NG 10.2.2 documentation - + @@ -1246,7 +1246,7 @@

        Building in the Open Build ServiceNote

        Abstract

        This document gives a brief overview how to build images with -KIWI NG in version 10.2.1 inside of the Open Build Service. +KIWI NG in version 10.2.2 inside of the Open Build Service. A tutorial on the Open Buildservice itself can be found here: https://en.opensuse.org/openSUSE:Build_Service_Tutorial

        diff --git a/working_with_images/build_with_profiles.html b/working_with_images/build_with_profiles.html index f67bd77564f..cb42e6a11d4 100644 --- a/working_with_images/build_with_profiles.html +++ b/working_with_images/build_with_profiles.html @@ -6,14 +6,14 @@ - Building Images with Profiles — KIWI NG 10.2.1 documentation + Building Images with Profiles — KIWI NG 10.2.2 documentation - + diff --git a/working_with_images/build_without_debianbootstrap.html b/working_with_images/build_without_debianbootstrap.html index 4f3858be572..4fa8e497289 100644 --- a/working_with_images/build_without_debianbootstrap.html +++ b/working_with_images/build_without_debianbootstrap.html @@ -6,14 +6,14 @@ - Circumvent Debian Bootstrap — KIWI NG 10.2.1 documentation + Circumvent Debian Bootstrap — KIWI NG 10.2.2 documentation - + diff --git a/working_with_images/clone_partitions.html b/working_with_images/clone_partitions.html index d12755c22d3..e2286309bcb 100644 --- a/working_with_images/clone_partitions.html +++ b/working_with_images/clone_partitions.html @@ -6,14 +6,14 @@ - Partition Clones — KIWI NG 10.2.1 documentation + Partition Clones — KIWI NG 10.2.2 documentation - + diff --git a/working_with_images/custom_fstab_extension.html b/working_with_images/custom_fstab_extension.html index f2b931ff9e5..ee9e8cde4e6 100644 --- a/working_with_images/custom_fstab_extension.html +++ b/working_with_images/custom_fstab_extension.html @@ -6,14 +6,14 @@ - Add or Update the Fstab File — KIWI NG 10.2.1 documentation + Add or Update the Fstab File — KIWI NG 10.2.2 documentation - + diff --git a/working_with_images/custom_partitions.html b/working_with_images/custom_partitions.html index 166c1b005be..22398191641 100644 --- a/working_with_images/custom_partitions.html +++ b/working_with_images/custom_partitions.html @@ -6,14 +6,14 @@ - Custom Disk Partitions — KIWI NG 10.2.1 documentation + Custom Disk Partitions — KIWI NG 10.2.2 documentation - + diff --git a/working_with_images/custom_volumes.html b/working_with_images/custom_volumes.html index 0bbc4446603..3c8b8696f42 100644 --- a/working_with_images/custom_volumes.html +++ b/working_with_images/custom_volumes.html @@ -6,14 +6,14 @@ - Custom Disk Volumes — KIWI NG 10.2.1 documentation + Custom Disk Volumes — KIWI NG 10.2.2 documentation - + diff --git a/working_with_images/disk_ramdisk_deployment.html b/working_with_images/disk_ramdisk_deployment.html index f535cac3b2d..1312b9513a6 100644 --- a/working_with_images/disk_ramdisk_deployment.html +++ b/working_with_images/disk_ramdisk_deployment.html @@ -6,14 +6,14 @@ - Deploy and Run System in a RamDisk — KIWI NG 10.2.1 documentation + Deploy and Run System in a RamDisk — KIWI NG 10.2.2 documentation - + diff --git a/working_with_images/disk_setup_for_azure.html b/working_with_images/disk_setup_for_azure.html index 542c22de6c8..e056ca038f7 100644 --- a/working_with_images/disk_setup_for_azure.html +++ b/working_with_images/disk_setup_for_azure.html @@ -6,14 +6,14 @@ - Image Description for Microsoft Azure — KIWI NG 10.2.1 documentation + Image Description for Microsoft Azure — KIWI NG 10.2.2 documentation - + diff --git a/working_with_images/disk_setup_for_ec2.html b/working_with_images/disk_setup_for_ec2.html index 7f1548ff363..64ca7e7e341 100644 --- a/working_with_images/disk_setup_for_ec2.html +++ b/working_with_images/disk_setup_for_ec2.html @@ -6,14 +6,14 @@ - Image Description for Amazon EC2 — KIWI NG 10.2.1 documentation + Image Description for Amazon EC2 — KIWI NG 10.2.2 documentation - + diff --git a/working_with_images/disk_setup_for_google.html b/working_with_images/disk_setup_for_google.html index 6d5e740fc61..8b73b79861e 100644 --- a/working_with_images/disk_setup_for_google.html +++ b/working_with_images/disk_setup_for_google.html @@ -6,14 +6,14 @@ - Image Description for Google Compute Engine — KIWI NG 10.2.1 documentation + Image Description for Google Compute Engine — KIWI NG 10.2.2 documentation - + diff --git a/working_with_images/disk_setup_for_luks.html b/working_with_images/disk_setup_for_luks.html index a5436b6cc9e..dfe75f42528 100644 --- a/working_with_images/disk_setup_for_luks.html +++ b/working_with_images/disk_setup_for_luks.html @@ -6,14 +6,14 @@ - Image Description Encrypted Disk — KIWI NG 10.2.1 documentation + Image Description Encrypted Disk — KIWI NG 10.2.2 documentation - + diff --git a/working_with_images/disk_setup_for_vagrant.html b/working_with_images/disk_setup_for_vagrant.html index 8b62eea698a..fe53262844d 100644 --- a/working_with_images/disk_setup_for_vagrant.html +++ b/working_with_images/disk_setup_for_vagrant.html @@ -6,14 +6,14 @@ - Image Description for Vagrant — KIWI NG 10.2.1 documentation + Image Description for Vagrant — KIWI NG 10.2.2 documentation - + diff --git a/working_with_images/iso_to_usb_stick_deployment.html b/working_with_images/iso_to_usb_stick_deployment.html index add3c2d6382..ea0c36caf55 100644 --- a/working_with_images/iso_to_usb_stick_deployment.html +++ b/working_with_images/iso_to_usb_stick_deployment.html @@ -6,14 +6,14 @@ - Deploy ISO Image on an USB Stick — KIWI NG 10.2.1 documentation + Deploy ISO Image on an USB Stick — KIWI NG 10.2.2 documentation - + diff --git a/working_with_images/iso_to_usb_stick_file_based_deployment.html b/working_with_images/iso_to_usb_stick_file_based_deployment.html index dc7731d6b4b..7d05d597514 100644 --- a/working_with_images/iso_to_usb_stick_file_based_deployment.html +++ b/working_with_images/iso_to_usb_stick_file_based_deployment.html @@ -6,14 +6,14 @@ - Deploy ISO Image as File on a FAT32 Formated USB Stick — KIWI NG 10.2.1 documentation + Deploy ISO Image as File on a FAT32 Formated USB Stick — KIWI NG 10.2.2 documentation - + diff --git a/working_with_images/iso_to_usb_stick_grub2_boot_from_iso.html b/working_with_images/iso_to_usb_stick_grub2_boot_from_iso.html index fc0ab09e01a..7ee1c2221fd 100644 --- a/working_with_images/iso_to_usb_stick_grub2_boot_from_iso.html +++ b/working_with_images/iso_to_usb_stick_grub2_boot_from_iso.html @@ -6,14 +6,14 @@ - Booting a Live ISO Images from Grub2 — KIWI NG 10.2.1 documentation + Booting a Live ISO Images from Grub2 — KIWI NG 10.2.2 documentation - + diff --git a/working_with_images/legacy_netboot_root_filesystem.html b/working_with_images/legacy_netboot_root_filesystem.html index 7a4694eafc3..bcc1c66c942 100644 --- a/working_with_images/legacy_netboot_root_filesystem.html +++ b/working_with_images/legacy_netboot_root_filesystem.html @@ -6,14 +6,14 @@ - Build PXE Root File System Image for the legacy netboot infrastructure — KIWI NG 10.2.1 documentation + Build PXE Root File System Image for the legacy netboot infrastructure — KIWI NG 10.2.2 documentation - + diff --git a/working_with_images/network_live_iso_boot.html b/working_with_images/network_live_iso_boot.html index 6dc1f49e0bd..905454310b1 100644 --- a/working_with_images/network_live_iso_boot.html +++ b/working_with_images/network_live_iso_boot.html @@ -6,14 +6,14 @@ - Booting a Live ISO Image from Network — KIWI NG 10.2.1 documentation + Booting a Live ISO Image from Network — KIWI NG 10.2.2 documentation - + diff --git a/working_with_images/network_overlay_boot.html b/working_with_images/network_overlay_boot.html index fad97259cb2..526302920b5 100644 --- a/working_with_images/network_overlay_boot.html +++ b/working_with_images/network_overlay_boot.html @@ -6,14 +6,14 @@ - Booting a Root Filesystem from Network — KIWI NG 10.2.1 documentation + Booting a Root Filesystem from Network — KIWI NG 10.2.2 documentation - + diff --git a/working_with_images/setup_network_bootserver.html b/working_with_images/setup_network_bootserver.html index d69bba6f636..1cc6e5f34f4 100644 --- a/working_with_images/setup_network_bootserver.html +++ b/working_with_images/setup_network_bootserver.html @@ -6,14 +6,14 @@ - Setting Up a Network Boot Server — KIWI NG 10.2.1 documentation + Setting Up a Network Boot Server — KIWI NG 10.2.2 documentation - + diff --git a/working_with_images/setup_yast_on_first_boot.html b/working_with_images/setup_yast_on_first_boot.html index a9f23213e94..45a726b11bd 100644 --- a/working_with_images/setup_yast_on_first_boot.html +++ b/working_with_images/setup_yast_on_first_boot.html @@ -6,14 +6,14 @@ - Setting Up YaST at First Boot — KIWI NG 10.2.1 documentation + Setting Up YaST at First Boot — KIWI NG 10.2.2 documentation - + diff --git a/working_with_images/use_suse_media.html b/working_with_images/use_suse_media.html index cdc754ac51f..eab2822c8d2 100644 --- a/working_with_images/use_suse_media.html +++ b/working_with_images/use_suse_media.html @@ -6,14 +6,14 @@ - Using SUSE Product ISO To Build — KIWI NG 10.2.1 documentation + Using SUSE Product ISO To Build — KIWI NG 10.2.2 documentation - +